(data stored in ACNUC7421 zone)

EMBL: CP000386.PE391

CP000386.PE391       Location/Qualifiers
FT   CDS_pept        complement(425058..426566)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0397"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: ATPase; KEGG:
FT                   atc:AGR_L_992 high affinity ribose transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03372"
FT                   /db_xref="GOA:Q1AZ06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ06"
FT                   /protein_id="ABG03372.1"
FT                   /translation="MPGEVSLSARHLAKRYGGVVALADGNLEVSSGEVVALMGANGSGK
FT                   STLGKIITGAVVPDSGTLLLDGEEVRFSSPHAARRAGIAAVYQELSLIPDMTVAENVWL
FT                   AHEPLSRGLVKRRERRERTARLLELFRGVVGPSLGPDALVSRLSPGERQIVEILKALSA
FT                   EPRLMILDEATASLDGEQVARLFELVGGWKAQGRAVVFVSHRMEEIFRIADRAVVLRSG
FT                   RTVGEAETSRTTEQELISLMIEGGVTKRHIEHPPGPAGGRKILLRAEDLRAPGVRGVSL
FT                   ELARGEILGLGGLQGQGQPELLRALFGALPRSGRLLLGGREVRLSHPRQAMREGMAFVP
FT                   GDRGREGLLRVRSILENLMLPSWRRYGRLLDLKRARRDAERIAGELRIVMGSLDDPVDT
FT                   LSGGNAQKVVLGKWLLRAPQILLLDDPTKGVDVGAKGELYAMLGDLRKEGVAILLYSSD
FT                   DEELLGLCDRVLVMREGRVRRELKSPELTRSALVKASVGTEDGG"
     atgcccggcg aggtctccct ctcggcccgg cacctcgcca agcgctacgg cggggtggtc        60
     gcgctcgccg acgggaacct ggaggtctcc tccggggagg tggtggccct catgggggcc       120
     aacggcagcg gcaagagcac gctgggcaag atcatcaccg gagcggtcgt ccccgactcg       180
     gggacgctgc tcctcgacgg ggaggaggtc cgcttctcct ccccgcacgc cgcccgcagg       240
     gcgggcatcg ccgccgtcta ccaggagctg agcctgatcc cggacatgac ggtggccgag       300
     aacgtctggc tggcccacga gcccctctcc cgcgggctcg tgaagcggcg cgagcggcgg       360
     gagcgcacgg cgcggctgct ggagctcttc cggggggtgg tgggcccctc gctcggcccc       420
     gacgccctcg tctcgcgcct ctcccccgga gagcgccaga tcgtggagat cctcaaggcc       480
     ctgagcgccg agccccgcct catgatcctg gacgaggcca ccgcgagcct cgacggggag       540
     caggtcgccc gcctcttcga gctcgtgggc gggtggaagg cccagggaag ggccgtggtc       600
     ttcgtctccc accggatgga ggagatcttc cgcatcgccg accgggcggt ggtgctccgc       660
     agcgggagga ccgtcggcga ggccgagacg tcgcggacga ccgagcagga gctgatctcc       720
     ctcatgatcg agggcggcgt gaccaaacgc cacatcgagc atccccccgg ccccgccggg       780
     gggaggaaaa tcctcctccg cgccgaagac ctgcgcgccc ccggggtgcg cggggtgagc       840
     ctcgagctcg cccggggcga gatcctcggc ctcggcggcc tgcaggggca ggggcagccc       900
     gagctgctgc gcgccctctt cggcgccctg ccgcgctccg gccgcctcct cctcggcggg       960
     agggaggtgc gcctctccca cccccggcag gccatgcgcg aggggatggc cttcgtcccc      1020
     ggcgaccggg gcagggaggg gctgttgcgc gtgcgctcca tcctcgagaa cctcatgctc      1080
     ccctcctggc ggcgctacgg gcggctgctc gacctgaagc gcgcccgccg ggacgccgag      1140
     aggatcgccg gggagctgcg gatagtcatg ggctcgctcg acgacccggt cgacaccctc      1200
     agcggcggca acgcccagaa ggtcgtcctc ggcaagtggc tgctgcgcgc gccgcagatc      1260
     ctgctgctcg acgacccgac caagggcgtg gacgtgggcg ccaagggcga gctctacgcg      1320
     atgctcggag acctcagaaa ggagggggtg gccatcctgc tctacagcag cgacgacgag      1380
     gagcttctgg ggctctgcga cagggtgctc gtcatgcgcg aggggcgggt gcgcagggag      1440
     ctcaagagcc ccgagctgac gaggtccgcg ctggtcaagg ccagcgtggg gacggaggac      1500
     gggggatga                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page