(data stored in ACNUC7421 zone)

EMBL: CP000386.PE393

CP000386.PE393       Location/Qualifiers
FT   CDS_pept        complement(427722..428930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0399"
FT                   /product="ROK domain containing protein"
FT                   /note="PFAM: ROK; KEGG: lxx:Lxx03030 transcriptional
FT                   regulator, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03374"
FT                   /db_xref="GOA:Q1AZ04"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZ04"
FT                   /protein_id="ABG03374.1"
FT                   /translation="MRSGESGTVGQIFGLIRSGRARTRAELAAVTGLTRATVSQRVEVL
FT                   MEAGLVVETKEGVSTGGRPPMVLGFNKDAGVVLAADLGATHCRLAVADLGGRPLVELPA
FT                   DLDIAQGPDAVLGWVQDRFEELLEEAGRSREEVWGIGVGVPGPVDFARGQAVSPPIMPG
FT                   WDRVPIPERFRERFGGVPVLVDNDVNIMALGEHRVNWSDVEHLLFVKVATGIGCGIVAG
FT                   GRIHRGERGAAGDIGHIRISGHEETVCRCGNVACVEAVAGGWALAKQLSGLGYPATGSR
FT                   DVVGLVRAGNPAAARLVRTAGELIGEVLASLVNFFNPAVIIIGGDLAHAHEQLFAGIRS
FT                   VVYQRSLPLATRHLQIVPSELDDRAGIHGAAAMVIEHVLRPETIEEMAQERIRRRAGRP
FT                   AGG"
     gtgaggtctg gcgagagcgg gacggtgggt cagatcttcg ggttgatccg cagcgggcgg        60
     gcccggacgc gggccgagct ggccgcggtg acggggctga cgcgggcgac ggtctcgcag       120
     agggtggagg tgctgatgga ggccgggctg gtcgtggaga ccaaggaggg ggtttcgacc       180
     ggcggacggc cgccgatggt gctcgggttc aacaaggacg cgggcgtggt gttggcggcg       240
     gacctggggg ccacccactg ccggcttgcg gtggcggacc tcgggggcag gccgctggtg       300
     gagctgccgg cggatctgga catcgcccag ggcccggacg cggtgctcgg gtgggtgcag       360
     gacaggtttg aggagctcct ggaggaggcg ggcaggagca gggaggaggt ctggggcatc       420
     ggggtggggg tgcccgggcc ggtggacttc gcccgcgggc aggccgtgag ccccccgatc       480
     atgcccggct gggaccgggt ccccatcccc gagcggttca gggagcggtt cggcggggtg       540
     cccgtgctgg tggacaacga cgtcaacatc atggcgctcg gggagcaccg ggtgaactgg       600
     tcggacgtgg agcacctgct cttcgtgaag gtggccaccg gcatcgggtg cggcatcgtg       660
     gcggggggca ggatccaccg cggggagcgg ggcgccgccg gggacatcgg gcacatccgg       720
     atcagcggcc acgaggagac cgtctgccgg tgcggcaacg tggcctgcgt ggaggcggtg       780
     gccggcgggt gggcgctggc caagcagctc agcgggctgg ggtacccggc gaccggcagc       840
     agggacgtgg tggggctcgt gcgggccggc aacccggccg cggcccggct cgtgcggacg       900
     gccggggagc tcatcgggga ggtgctggcg agcctggtca acttcttcaa cccggcggtg       960
     atcatcatcg gcggggacct ggcgcacgcc cacgagcagc tgtttgccgg gatacgctcg      1020
     gtcgtctacc agcggtcgct gccgctggcg acgcggcacc tgcagatcgt cccctccgag      1080
     ctcgacgacc gggccgggat acacggggcg gcggcgatgg tgatcgagca cgtactgcgc      1140
     cccgagacga tcgaggagat ggcgcaggag aggatccggc ggagggccgg gaggccggcc      1200
     ggcgggtag                                                              1209
//

If you have problems or comments...

PBIL Back to PBIL home page