(data stored in ACNUC7421 zone)

EMBL: CP000386.PE398

CP000386.PE398       Location/Qualifiers
FT   CDS_pept        435009..435254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03379"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ9"
FT                   /protein_id="ABG03379.1"
FT                   /translation="MHRDFMYEMARERMAEYHREAERRRRSGPSGRGVWRRWVARRLFE
FT                   AAFSVDAEEGWRAMWDRMSAPGRRGRRSSGARKVAG"
     atgcacaggg atttcatgta cgagatggcg cgggagcgga tggccgagta ccaccgggag        60
     gcggagcgcc ggaggaggtc ggggccttcg gggaggggcg tctggaggcg ctgggtcgcc       120
     cggcgcctct tcgaggcggc cttctcggtc gacgccgagg agggctggag ggcgatgtgg       180
     gacaggatgt ccgctcccgg gcgccggggc aggaggtcgt ccggcgcccg gaaggttgcg       240
     gggtga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page