(data stored in ACNUC7421 zone)

EMBL: CP000386.PE4

CP000386.PE4         Location/Qualifiers
FT   CDS_pept        3171..4295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC protein-like; KEGG: oih:OB0004 DNA repair and
FT                   genetic recombination"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ABG02985"
FT                   /db_xref="GOA:Q1B043"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B043"
FT                   /protein_id="ABG02985.1"
FT                   /translation="MSAHIRAIRLVNFRNYAGATALLSPGLNVLVGENAQGKTNLLEAL
FT                   AFVVSGSSPRTPNDSEVVRWGEGFVRVEARVVDGGHERRLAVGYAPGSRKRLTVDGAPV
FT                   ESLARYAAGVAGVRAVTFFPDDLRVVKGSPSDRRSFLDALLSSLRPAYARAAAEYARAV
FT                   QQRNQLLRRIRDGLSSERTLATWDRKVVELGLVLLEGRAAAAAPLDEHFRASMRALYGP
FT                   QKAAVGYSYSATPERYAQALREAHSADIERGITSVGPHRDDLRILLEGVDLTTYGSQGQ
FT                   QRLATLALKFAARDYIRDATGQDPVLLFDDVMSELDERRRDYLAGCFLESTQAVISTTN
FT                   LRYFEPGALRRARVLGISGGSISQTTKSGVDNGG"
     ttgagcgccc acatccgggc catccggctc gtgaacttcc ggaactacgc cggcgcgacg        60
     gcgctcctct cgccggggct caacgtgctc gtcggggaga acgcccaggg gaagacgaac       120
     ctcctcgagg cgctggcctt cgtcgtctcc ggctcctcgc cccgcacgcc caacgactcg       180
     gaggtcgtcc gctgggggga ggggttcgtg cgggtagagg cccgggtggt cgacggaggg       240
     cacgagcgcc ggttggccgt gggctacgcc cccggcagca ggaagcgcct caccgtggac       300
     ggcgctcccg tggagtcgct ggcccgctac gctgccgggg ttgcgggcgt gcgggcggtg       360
     accttcttcc cggacgacct ccgggtcgta aagggttctc cctcggaccg caggtctttc       420
     ctcgacgccc tgctctcctc cctgcggccg gcctacgccc gggcggcggc cgagtacgcc       480
     agggccgtcc agcagcgcaa ccagctgctg cggcgcatcc gcgacggcct ctcctcggag       540
     cggacgctcg ccacctggga ccggaaggtc gtggagctgg ggctcgtgct gctagagggg       600
     cgcgccgcgg ccgcagcgcc cctcgacgag cacttcagag cctccatgag ggccctgtac       660
     ggcccccaga aggccgccgt gggctactcc tatagcgcga cacccgagcg ctacgcgcag       720
     gccctcagag aggctcacag cgccgacata gagcgcggca tcacctccgt aggaccgcac       780
     agggacgacc tcaggatcct gctcgagggc gtcgacctca ccacctacgg ctcccagggc       840
     cagcagcggc tcgccaccct ggccctcaag ttcgccgccc gggactacat ccgcgacgcc       900
     accgggcagg accccgtgct gctcttcgac gacgtcatga gcgagctcga cgagcgccgc       960
     agggactacc tcgccggttg cttcctcgag agcacccagg ccgtcatctc caccaccaac      1020
     ctccggtact tcgagccggg cgccctgcgg cgcgcccgcg tcctcggcat atctggtggt      1080
     tcgatatccc agactacaaa aagtggtgta gacaacgggg gctga                      1125
//

If you have problems or comments...

PBIL Back to PBIL home page