(data stored in ACNUC7421 zone)

EMBL: CP000386.PE40

CP000386.PE40        Location/Qualifiers
FT   CDS_pept        42266..42988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0040"
FT                   /product="DnaD and phage-associated region"
FT                   /note="PFAM: DnaD and phage-associated region; KEGG:
FT                   ctc:CTC02142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03021"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B007"
FT                   /protein_id="ABG03021.1"
FT                   /translation="MDSVRLTPPGERRVRGERARLYIRWMPHLGAEAVALYELLRVLPE
FT                   VGLDEVEVQELAELLRSTPEGVREALKTLEENGFLVRREGWTEVAGPPPAPGRAPAAPE
FT                   RPARDIRVIRAADEGVSADDYFRYMGSLPSPHILEFLNGYCERDGMSPDVVREALRIAS
FT                   ERDARRVGYVRSILERWVERGVKTVEDVERFEQDRRLRLVQHGGAPAERTGEGVQEDGA
FT                   HRRPAARRREDYRWFFGE"
     atggacagcg tcaggctcac accgccgggg gagcgccgcg ttcggggaga gcgggcccgg        60
     ctctacatcc gctggatgcc ccacctgggc gccgaggccg tggcgctcta cgagctgctg       120
     cgcgtcctcc ccgaggtcgg gctggacgag gtggaggtgc aggagctcgc cgagctgctg       180
     cgctccaccc ccgagggggt gcgggaggcc ctcaagacgc tggaggagaa cggctttctg       240
     gtgcggcgcg aggggtggac cgaggtcgcc ggaccccctc ccgcccccgg gcgcgcgccg       300
     gccgcgcccg agcgtcccgc ccgcgacata cgggtgatcc gggccgccga cgagggcgtc       360
     tccgccgacg actacttccg gtacatgggc tcgctgccct ccccgcacat cctggagttc       420
     ctcaacggct actgcgagcg ggacgggatg tcgcccgacg tggtgcgcga ggcgctccgg       480
     atcgccagcg agcgggacgc ccgcagggtc ggctacgtcc ggagcatcct ggagcggtgg       540
     gtcgagcgcg gcgtgaagac ggtcgaggac gtcgagcgct tcgaacagga caggaggctg       600
     cggctcgtgc agcacggcgg cgccccggcg gagaggaccg gagagggggt gcaagaagat       660
     ggagcgcata ggcgacctgc tgcccgacgc cgggaagatt accgctggtt cttcggggag       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page