(data stored in ACNUC7421 zone)

EMBL: CP000386.PE400

CP000386.PE400       Location/Qualifiers
FT   CDS_pept        436053..436892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0406"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: ape:APE2512
FT                   putative ABC-2 type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03381"
FT                   /db_xref="GOA:Q1AYZ7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ7"
FT                   /protein_id="ABG03381.1"
FT                   /translation="MIRGGGRPRWLMEAIAVWGYVQRNYFLTKRYFMWEVVWLVYITAN
FT                   ALAITYIGAGASEFGSGIDTARLMTFLLVGALVWSYLSVLFDVLSETVSWERWEGTIEY
FT                   TFMSPASRVTHLLGMGLYAVIYGVLQISVMLGAVSLFFELDLSRANYAGALLVLGVASV
FT                   SLVGFGIMAAVLPLLSPEKGQQVSYIVSSLLLLVSGVYYDVGVLPGWMQFIARFSPVTY
FT                   ALEGIRAALLDGAGLAELRGSVGVLLAMGALFVPLGLLVFHLGERYAKRTGKLKRSG"
     gtgatccggg gcgggggaag gccgcggtgg ctcatggagg ccatagccgt gtggggctac        60
     gtgcagagga actacttcct caccaagcgg tacttcatgt gggaggtcgt gtggctcgtc       120
     tacatcacgg cgaacgccct ggcgatcacc tacatcggcg ccggcgcgag cgagttcggc       180
     agcggcatag acaccgcgcg cctgatgacc ttcctgctgg tgggggcgct cgtctggagc       240
     tacctctcgg tgctcttcga cgtgctctcg gagacggtga gctgggagcg gtgggagggg       300
     accatcgagt acaccttcat gagcccggcg agcagggtca cccacctgct cgggatgggg       360
     ctctacgcgg tcatctacgg cgtcctccag atctcggtga tgctcggggc ggtctcgctc       420
     ttcttcgagc tggacctctc gcgggccaac tacgcgggcg ccctgctggt gctcggcgtg       480
     gcgagcgtct cgctggtggg cttcggcatc atggccgccg tgctgcccct gctctccccg       540
     gagaagggcc agcaggtgag ctacatcgtc tcctccctgt tgctgctcgt ctccggcgtc       600
     tactacgacg tgggcgtgct gccggggtgg atgcagttca tcgctcggtt ctcgcccgtc       660
     acgtacgccc tggagggcat ccgcgccgcc ctgctcgacg gggcgggcct cgcggagctg       720
     cggggcagcg tcggggtgct tctggcgatg ggggcactct tcgtgccgct cgggctcctc       780
     gtgttccacc tcggcgagcg ctacgccaag aggaccggaa agctgaagcg gagcgggtag       840
//

If you have problems or comments...

PBIL Back to PBIL home page