(data stored in ACNUC7421 zone)

EMBL: CP000386.PE404

CP000386.PE404       Location/Qualifiers
FT   CDS_pept        complement(440611..442347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0410"
FT                   /product="IucA/IucC"
FT                   /note="PFAM: IucA/IucC; KEGG: ana:all0394 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03385"
FT                   /db_xref="GOA:Q1AYZ3"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ3"
FT                   /protein_id="ABG03385.1"
FT                   /translation="MLDQRMTARQIADHAAMQNLLNCFLRETGRGAFLREGAVLVPLER
FT                   LGMEVLAPLRRPSPTGRHLFGFPVTAGPCGDPRRAELDPATLAALISRELSLERGGSPE
FT                   ELLLRVLESRRNVERFVGARLEEGKRPREGFIGAEQSLVFGHHLHPAPKSRQGFAEEEL
FT                   AAYSPEMGAAFPLHYFWAHRSVVSEGSALPQSASQLVAEELRRDPEARTLPREDQDRAL
FT                   IPAHPWQAGRLLRRPEVRRLIGEGLLEHLGPLGSPYLPTSSVRTVYRPRSRFMLKLSLG
FT                   VGITNSVRNNLRKELRRGIKMCRVLESAVGRELRERFPGFRIIRDPAHITVETGVGEES
FT                   GFEMLLRENPFRGDEDAAAVVALCQDGLGEEGSRLARLVARLARREGRPPSEVGREWFR
FT                   RYLEVSLRPILWLYFAHGIAPEAHQQNTVLELEGGYPARFYCRDNQGYYFRESAREHLE
FT                   RLVPGVHGIEDGTVVEDPVAEERLRYYFFINNLFGVVNALGCAGLADERELLGELRRAL
FT                   EELEPEAPASSELIPSLLHLRRLPCKANLLTRLHDMDELLGDLETQSVYVEIDNPLAEV
FT                   SA"
     atgctcgacc agcgcatgac ggcccggcag atcgccgacc acgcagcgat gcagaacctg        60
     ctcaactgct ttctgcggga gacagggagg ggagccttcc tccgggaggg ggccgtcctg       120
     gtccccctgg agaggctggg gatggaggtg ctcgcgcccc tgcgccgccc ctcccccacc       180
     gggcggcacc tcttcggctt tcccgtcacg gcgggcccgt gcggcgaccc gcgccgggcg       240
     gagctggacc ccgcgacgct ggccgccctg atctcccggg agctctccct ggagcggggc       300
     ggctcccccg aggagctgct gctgcgcgtc ctggagagcc gccgcaacgt ggagcgcttc       360
     gtgggggcgc gcctggagga aggaaagcgc ccgcgggagg ggttcatagg ggcggagcaa       420
     tcgctcgtct tcggccacca cctccacccc gcccccaaga gccggcaggg gttcgccgag       480
     gaggagctcg ccgcctactc gcccgagatg ggggccgcct tccccctgca ctacttctgg       540
     gcccaccgct ccgtggtatc cgagggctcg gcgctcccgc agagcgcctc gcagctcgtc       600
     gcggaggagc tccggcggga cccggaggcc cgaacgctcc cccgagaaga ccaagaccgc       660
     gccctcatcc cggcccaccc ctggcaggcg gggaggctgc tgcggcgccc ggaggtgcgg       720
     cgcctgatcg gggaggggct gttggagcac ctcgggcctc tggggagccc ctacctcccc       780
     acctcctcgg tgcgcaccgt ctaccgcccc cggtcccgct tcatgctcaa gctctccctg       840
     ggcgtgggga tcaccaactc cgtccggaac aacctgcgca aggagctcag gcggggcata       900
     aagatgtgcc gcgtgctgga gagcgcggtg gggcgggagc tccgggagcg ctttccgggg       960
     ttccggatca tccgcgaccc cgcccacatc accgtggaga cgggcgtcgg ggaggagtcg      1020
     ggcttcgaga tgctgctgcg ggagaacccc ttccgcggcg acgaggacgc cgccgcggtc      1080
     gtcgcgctgt gccaggacgg gctgggggag gagggctcgc gcctggcccg cctggtggct      1140
     cgcctcgccc ggcgggaggg gcgcccgccg tccgaggtgg gccgggagtg gttccggcgc      1200
     tacctggagg tctcgctgcg gcccatcctc tggctgtact tcgcccacgg catcgccccg      1260
     gaggcccacc agcagaacac cgtgctggag ctggagggcg gctacccggc ccgcttctac      1320
     tgccgggaca accagggcta ctacttccgc gagtcggccc gggagcacct ggagcggctc      1380
     gtccccgggg tgcacggcat cgaggacggg accgtggtgg aggaccccgt cgccgaggag      1440
     cggctgcgtt actacttctt catcaacaac ctcttcgggg tcgtaaacgc cctcgggtgc      1500
     gccgggctcg ccgacgagcg ggagctgctc ggcgagctgc gccgggcgct ggaggagctc      1560
     gagccggagg cccccgcgtc ttcggagctg atcccgagcc tcctgcacct gcgaaggctc      1620
     ccctgcaagg ccaacctgct cacccggctg cacgacatgg acgagctcct cggcgacctg      1680
     gagacccagt cggtctacgt ggagatagac aaccccctgg cggaggtgag cgcgtga         1737
//

If you have problems or comments...

PBIL Back to PBIL home page