(data stored in ACNUC7421 zone)

EMBL: CP000386.PE406

CP000386.PE406       Location/Qualifiers
FT   CDS_pept        complement(445285..446244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0413"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: gka:GK1457
FT                   iron(III) dicitrate ABC transporter (lipoprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03387"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYZ1"
FT                   /protein_id="ABG03387.1"
FT                   /translation="MSWWRGFVISVLLAAGALGLAACGGASGGSSGGEEGSGGRIIEHA
FT                   MGRTEVPERPERVVVLDTGELDSAITLGVKPVGAVEAVPGMGLPEYLGEKTRGIELVGT
FT                   IEQPNLEKIAALDPDLILSSKLRHEKIYDQLSEIAPTVFTETTGVTWKQNFELHARALG
FT                   RTERAEEVKREYRRHIRELRDELGEKPWPEVSVVRFVPGDTRIYQKENFIGTVLEDVGL
FT                   PRPESQDVEEFALLNVSKEAIPKMGGDVIFVTVYGNEEDTAKQEIMNDPLWRQLEAVRE
FT                   GRVYEVSDDLWMLGIGYTAANGVLDDLEKYLAEERRAS"
     atgtcatggt ggagggggtt tgtgatctct gtcctgctcg ccgcgggggc gctcgggctc        60
     gcggcctgcg gcggggcctc ggggggctcc tcgggcgggg aggagggctc cggcgggagg       120
     atcatagagc acgccatggg ccggaccgag gtccccgagc ggcccgagcg ggtcgtcgtg       180
     ctcgacaccg gcgagctcga cagcgccata acgctcggcg tcaagccggt gggggcggtg       240
     gaggccgtgc ccgggatggg gctgccggag tacctcgggg agaagacccg gggcatagag       300
     ctcgtgggca ccatcgagca gccgaacctg gagaagatag ccgcgctgga ccccgacctc       360
     atcctctcca gcaagctccg gcacgagaag atctacgacc agctctccga gatagcgcca       420
     accgtcttca ccgagaccac cggggtcacc tggaagcaga acttcgagct gcacgccagg       480
     gcgctcggca ggaccgagag ggccgaggag gtcaagcgcg agtaccggcg gcacatacga       540
     gagctccgcg acgagctcgg cgagaagccc tggcccgagg tctccgtggt ccggttcgtc       600
     cccggggaca ccaggatcta ccagaaggag aacttcatcg gcaccgtgct cgaggacgtg       660
     gggctgccgc gccccgagtc ccaggacgtc gaggagttcg ccctgctcaa cgtcagcaag       720
     gaggccatcc ccaagatggg cggggacgtg atcttcgtga ccgtctacgg caacgaggag       780
     gacaccgcca agcaggagat catgaacgac cccctctggc ggcagctgga ggccgtgcgc       840
     gagggcaggg tctacgaggt ctccgacgac ctgtggatgc tcgggatcgg ctacaccgca       900
     gcaaacggcg tcctcgacga cctggagaag tatctggcag aggagcggcg ggcctcctga       960
//

If you have problems or comments...

PBIL Back to PBIL home page