(data stored in ACNUC7421 zone)

EMBL: CP000386.PE410

CP000386.PE410       Location/Qualifiers
FT   CDS_pept        449289..450092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fra:Francci3_4381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03391"
FT                   /db_xref="GOA:Q1AYY7"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR024726"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY7"
FT                   /protein_id="ABG03391.1"
FT                   /translation="MSGSPLAEALGRVDPDRHRFRMRAGASGEGWVVAAELVSDAALAG
FT                   RQIQRARSRWGLRRREAAAYLVGSYAWGVGGPAAAAYVLARRVPDLSPQNVLVRLDEGG
FT                   GIPEAALCGGRFAALASDPASGHPEALAFPGEPELLAWMRGRLVAGLGPLVELVSGLTR
FT                   VGGRTLWGRAADLLAQSFLMVGEDTPDQVGCMRDARAFVSGLPFGERVGFFVVGSGERR
FT                   RAFMRRSICCQAYRNPGYGYCDSCPALSQEERERRALEELARIRA"
     gtgagcggct ccccgctcgc ggaggccctg gggcgcgtgg acccggaccg ccaccgcttt        60
     cgcatgcggg ccggggccag cggggagggc tgggtcgtgg ccgcggagct cgtctcggac       120
     gcggcgctcg ccggccggca gatacagcgg gcccggagca ggtggggcct gcgccgccgc       180
     gaggcggccg cctacctcgt cggctcctac gcctggggcg tcggggggcc ggcggccgcc       240
     gcctacgttc tggcccggcg cgtccccgac ctctccccgc agaacgtcct cgtgcggctc       300
     gacgagggcg ggggcatccc cgaggccgcg ctctgcgggg ggcgcttcgc cgccctggcc       360
     tccgaccccg cctcggggca cccggaagcc ctcgccttcc ccggagagcc cgagctgctc       420
     gcctggatgc gcgggcgcct cgtagccggg ctcggcccgc tcgtcgagct cgtctccggg       480
     ctcacccgcg tcggcgggcg gaccctgtgg gggcgggccg ccgacctcct cgcccagagc       540
     ttcctcatgg tcggggagga caccccggac caggtggggt gcatgcggga cgcccgggcc       600
     ttcgtctcgg gcctcccctt cggggagagg gtcggcttct tcgtcgtggg gagcggggag       660
     aggcgccggg cgttcatgag gcgcagcatc tgctgccagg cctacaggaa ccccgggtac       720
     ggctactgcg actcctgccc ggcgctctcc caggaggagc gggagcgccg ggccctggag       780
     gagctggcga ggatccgggc ttag                                              804
//

If you have problems or comments...

PBIL Back to PBIL home page