(data stored in ACNUC7421 zone)

EMBL: CP000386.PE411

CP000386.PE411       Location/Qualifiers
FT   CDS_pept        450117..451160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0418"
FT                   /product="Twin-arginine translocation pathway signal"
FT                   /note="TIGRFAM: Twin-arginine translocation pathway signal;
FT                   PFAM: periplasmic binding protein; KEGG: cjk:jk1776
FT                   putative iron ABC transport system, solute binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03392"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY6"
FT                   /protein_id="ABG03392.1"
FT                   /translation="MAETVERLGSSRRPGCRRTTRREFLAGAAALLVLPAGCAGGSGGA
FT                   SGGSRAVEHRYGVTRISGRPRRVISLGYQEHDALFALGVEPVAVRYWYGDRDDVIHPWA
FT                   EDEAGEADPEILDMPFGELNFERMAALEPDLIMGVYAGLTRDEYETLSEIAPTVAQPAG
FT                   YVNFGTPWQRATLMAGRAVGREGRARRLVSRVEGRFEEARREHPRFDGATVAVASYGTG
FT                   EKIGFFSSQDARARFFTGLGFRVPERLDELAGESFYGTISPERMDLLDADLLVWCQLAS
FT                   TEGGREAIERDPLVRRLAASREGRMFFMEGVLDDALQFGTVLSLPFLLERAVPGIAAAV
FT                   DGDPQTT"
     atggcggaga cggtggagcg tttgggttct tcgcgccggc cggggtgccg gcggacgacg        60
     cgtcgggagt ttctcgccgg ggctgcggcg ctgctcgttc tgcccgcggg gtgcgcgggc       120
     ggctccggcg gggcctccgg cgggagccgc gccgtggagc accggtacgg cgtcaccagg       180
     atctccggcc ggccccggcg cgtgatctcc ctcggctacc aggagcacga cgcgctcttc       240
     gcgctcggcg tggagccggt cgccgtgcgc tactggtacg gcgaccggga cgacgtaatc       300
     cacccctggg ccgaggacga ggccggggaa gcggaccccg agatcctcga catgcccttc       360
     ggggagctca acttcgagag gatggccgcg ctggagcccg acctgatcat gggcgtctac       420
     gccggcctca cgcgggacga gtacgagacc ctctccgaga tagcccccac cgtagcccag       480
     cccgcgggct acgtgaactt cgggacgccc tggcagaggg cgaccctgat ggccggaagg       540
     gccgtggggc gggagggtcg ggcgcggcgg ctggtctcga gggtcgaggg gcgcttcgag       600
     gaggcccgca gggagcaccc ccgcttcgac ggggccaccg tcgccgtcgc cagctacggt       660
     accggagaga agatcggctt cttctcctcc caggacgcgc gggcccgctt cttcaccggg       720
     ctcggcttcc gggtgcccga gcggctggac gagctcgccg gggagagctt ctacggcacc       780
     ataagccccg agcggatgga cctcctcgac gccgacctgc tggtctggtg ccagctggcc       840
     tccaccgagg gcgggagaga ggccatcgag cgcgacccgc tggtgcggcg gctcgcggcc       900
     agccgggagg ggcgcatgtt cttcatggag ggggtgctcg acgacgcgct ccagttcggc       960
     accgtgctga gcctgccctt cctgctcgag cgggcggtgc ccggcatagc cgccgcggtc      1020
     gacggcgacc cgcagaccac ctga                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page