(data stored in ACNUC7421 zone)

EMBL: CP000386.PE416

CP000386.PE416       Location/Qualifiers
FT   CDS_pept        complement(455081..455803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0423"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: sai:Saci_0388
FT                   conserved archaeal membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03397"
FT                   /db_xref="GOA:Q1AYY1"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYY1"
FT                   /protein_id="ABG03397.1"
FT                   /translation="MRLDPPDSYWKKDVALFLGRRLSLAIKMLYPAAIILPVAASGIPA
FT                   QYAAAVVGLVAIMAGTFGAGESLTNDINDGILVRVALTPLSPYRIVAEILVVNAALDFL
FT                   QLLPALAGVYLLHPAPPAWVLAATVAVFATLLTANAIGVLLANFTSSPADVLLYATIVL
FT                   FPLIYLSGFFRNQHPEGLLAALRHLVPFAYMNDALKEIFGLATAASPLAVILVPTLLGA
FT                   LAAAAVCLTAPRLLSPRL"
     atgaggcttg accctccgga cagctactgg aagaaggacg tcgcgctctt tctcggcagg        60
     cgcctctcgc tcgccataaa gatgctctac ccggcggcca tcatcctccc ggtcgcggcg       120
     agcgggatac cggcgcagta cgcggcggcg gtggtcggtc tggtggccat catggcgggc       180
     accttcgggg caggcgagag cctgacgaac gacataaacg acgggatcct ggtgcgcgtg       240
     gcgctcaccc ccctctcgcc gtaccggatc gtcgcggaga tccttgtggt caacgcggcc       300
     ctggacttcc tccagctcct gccggcgctc gccggggtgt acctcctgca cccggcgccg       360
     ccagcctggg tgctcgcggc gaccgtcgcc gtcttcgcca ccctgctcac cgccaacgcc       420
     ataggcgtgc tgctcgccaa cttcacctcc tccccggccg acgtgctgct gtacgccacc       480
     atagtgctct tcccgctcat ctacctctcc ggcttcttca ggaaccagca ccccgagggc       540
     ctgctcgcgg cgctgcgcca tctcgtgccc ttcgcctaca tgaacgacgc cctcaaggag       600
     atcttcgggc tggccaccgc agcgagcccc ctcgccgtca tcctcgtccc caccctcctc       660
     ggggcgctcg cggccgccgc cgtctgcctc accgccccgc gtctcctctc cccgcggctg       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page