(data stored in ACNUC7421 zone)

EMBL: CP000386.PE418

CP000386.PE418       Location/Qualifiers
FT   CDS_pept        456903..457787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0425"
FT                   /product="6-phosphogluconate dehydrogenase, NAD-binding
FT                   protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase, NAD-binding;
FT                   KEGG: sma:SAV1542 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03399"
FT                   /db_xref="GOA:Q1AYX9"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX9"
FT                   /protein_id="ABG03399.1"
FT                   /translation="MNGNVSVAVLGTGIMGSAMARNLLKAGMEVRVWNRTRSRAEPLAA
FT                   EGARVADSPREAARGAGVLLTMLADAGAVAGAVGGGALEALSPGAVWLQMSTVGVEGTG
FT                   RLQRMALERGVAYVDAPVLGTRQPAEAGELVVLASGPEEVRPACEPVFEAVGKKTLWVG
FT                   PVGAGTRLKLVVNNWITGLLGVLGETFALAQKLGVDPSLFFEAVEGGPLDLPYARAKGK
FT                   MMAEGEYPTSFSVRLARKDAGLVLEAAEDLRLPVCEAVAYHLDRAAETGHAEDDMAAIY
FT                   EGVRTAAEPGGAG"
     ttgaacggga acgtatccgt ggcggtgttg gggaccggga tcatggggag cgcgatggcc        60
     cgcaacctcc tgaaggcggg catggaggtg cgggtctgga accgcacccg cagcagggcc       120
     gagccgctcg ccgccgaggg cgcgcgggtc gcggacagcc cgcgggaggc ggcccggggg       180
     gcgggcgtcc tcctcaccat gctcgccgac gccggcgccg tggccggggc ggtgggcggc       240
     ggcgctctgg aggcgctctc tcccggcgcc gtgtggctcc agatgagcac cgtgggggtg       300
     gagggaaccg ggaggctgca gcgcatggcg ctcgagcgcg gggtggccta cgtcgacgcc       360
     ccggtgctcg gcaccaggca gcccgccgag gccggggagc tggtggtgct ggcctccggc       420
     cccgaggagg tgcgcccggc gtgcgagccg gtcttcgagg ccgtgggcaa gaagacgctg       480
     tgggtcggcc ccgtgggggc gggcacccgg ctcaagctgg tggtgaacaa ctggatcacg       540
     ggtctgctcg gcgtgctggg ggagaccttc gccctcgcgc agaagctggg cgtggacccc       600
     tccctcttct tcgaggccgt ggagggcggg ccgctggacc tgccctacgc ccgcgcgaag       660
     gggaagatga tggccgaggg ggagtacccc acgagcttct cggtgaggct cgcccgcaag       720
     gacgcggggc tggtcctgga ggcggcggaa gacctgcggc tgccggtgtg cgaggccgtg       780
     gcctaccacc tcgaccgggc cgccgagacc gggcacgcgg aggacgacat ggccgcgatc       840
     tacgaggggg tgaggaccgc ggcggagccc ggaggggcgg gctag                       885
//

If you have problems or comments...

PBIL Back to PBIL home page