(data stored in ACNUC7421 zone)

EMBL: CP000386.PE42

CP000386.PE42        Location/Qualifiers
FT   CDS_pept        43790..44395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03023"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B005"
FT                   /protein_id="ABG03023.1"
FT                   /translation="MREEFLITRQGRQYVLFAGLLDEAHARGLRSIETELLQVPEEANG
FT                   MTAIVRARVEMEDGRTFSGLGDANPQNVGRSIAPHLIRMAETRAKARALRDAVNVGATA
FT                   LEELTDGEESPPVEEARSRRPRPVEEAPPGEGGSEAGRRGGRVRRSQLELLRTLAVEAR
FT                   GENGVERLERHIGKPLSELTREEAEAWIDRLTPAGGRE"
     atgagggaag agttcctgat aacccgccag ggacgccagt acgtcctctt cgccggtctc        60
     ctggacgagg cccacgcccg gggcttgagg agcatagaga ccgagcttct gcaggtgccc       120
     gaggaggcga acgggatgac ggccatagtg cgggcgcggg tggagatgga ggacggccgg       180
     actttcagcg gcctcgggga cgccaacccg cagaacgtgg gccggtccat agcgccgcac       240
     ctgatccgga tggccgagac gcgggccaag gcgcgggcgc tcagggacgc ggtgaacgtg       300
     ggggccaccg cgctggagga gctgaccgac ggcgaggagt ccccgccggt ggaggaggcc       360
     cggtcccgca ggccccgccc ggtggaggag gcgccccccg gcgagggggg ttcggaggcg       420
     gggcgccgcg gcgggagggt gcgcaggagc cagctcgagc ttttgcggac gctcgcggtg       480
     gaggcgcgcg gcgagaacgg ggtcgagcgc ctggagcggc acatcgggaa gcccctctcc       540
     gagctcaccc gggaggaggc cgaggcctgg atagaccgcc tcacccccgc cggggggcgg       600
     gagtag                                                                  606
//

If you have problems or comments...

PBIL Back to PBIL home page