(data stored in ACNUC7421 zone)

EMBL: CP000386.PE423

CP000386.PE423       Location/Qualifiers
FT   CDS_pept        complement(461323..463365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gvi:glr3133 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03404"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX4"
FT                   /protein_id="ABG03404.1"
FT                   /translation="MSSRQTGRLGLERHRMLVGREEERRLLEEALAGGEPPFAVLYVFG
FT                   IGGCGKTALLREFAYLCEEAGTRALYLDAHRLTEPPLPLLLERARPGRRVILLDGCERL
FT                   PPLQEWVDEDLLLGLQEGLLLVLSGRSPPPAEWLADPGWRSLVRLLPLGNLGEQESREL
FT                   LARRGLHPRQQRGVLGFARGHPLALSLAADAALRNPLGRFGPEEEIEVVGTLAGHLVGE
FT                   LPGPEHREALEVCALSRHTTESLLARAVPGAEPGELFGWLRGLSFVRPGPLGLVPHPTA
FT                   REVLAADLRWRDPDRHARLLRRVRRYHVARLGESRGAERQRALLDYLFLHREDPEVRPL
FT                   LGRGEADGASAGPPRPGDSARLEKAVERHEGPASGRLARRLLSRGSLEVAIYRDPAGRP
FT                   AGFAASLRLRRAGGEERDPAALAALRHLEGRGPLRTGEEAALLRFWMARSSYQSGPALR
FT                   GILLDAVLRHVLDAPPPACTLLVVADPPRSGRALDRLGFPRLPGEGFAVGGRRYALYGH
FT                   DWRTVPPGDWLDLLAERGPAGEALAGPAGERPAVLEREEFASAVREALKNHARPGALAS
FT                   SPLLRSRLVARRTGGGSGERERVAALRALLEEAAETLRQHPRDARLYRALHHTYFRPAP
FT                   TQEQAARLLGLPFSTYRRHLRAGIENVTDLLWRQETHPPAKPDRK"
     gtgtcctcac gacagaccgg ccgcctcggc ctggagcggc accggatgct ggtcggccgg        60
     gaggaggaga ggcggctgct cgaggaggcc cttgccggcg gggagccgcc cttcgccgtg       120
     ctctacgtct tcgggatcgg cggctgcggg aagacggcgc tgctccggga gttcgcgtac       180
     ctctgcgagg aggcggggac gagggcgctc tatctcgacg cgcaccggct caccgaacct       240
     cccctgccgc tgctcctgga gagagcgcgg ccgggaaggc gcgtgatcct gctcgacggg       300
     tgcgagcgcc tgccgccgct gcaggagtgg gtggacgaag acctgctcct cgggctgcag       360
     gagggcctgt tgctggtgct ctccgggcgc tccccgcccc ccgccgagtg gctggcggac       420
     cccggctggc ggagcctggt gcgcctcctg ccgctgggca acctgggcga gcaggagagc       480
     cgggagcttc tggcccggcg ggggctccac ccgcggcagc agcgcggcgt gctgggcttc       540
     gcccgcgggc accccctcgc cctctccctc gccgccgacg ccgcgctccg gaaccctttg       600
     ggccgcttcg ggccggagga ggagatagag gtcgtcggca ccctcgccgg gcacctggtc       660
     ggcgagctcc ccggacccga acacagggag gcgctggagg tttgcgccct ttcccggcac       720
     accacggagt ccctcctggc ccgcgccgtc ccgggggcgg agccgggaga gctcttcggg       780
     tggctgcgcg gcctgagctt cgtccggccc gggccgctgg ggctggtccc gcaccccacc       840
     gcgcgcgagg tcctcgccgc cgacctgcgc tggcgcgacc cggaccgcca cgcccgcctg       900
     ctccggcggg tgcgccgcta ccacgtcgcc cgcctcgggg agagccgggg cgccgagcgg       960
     cagcgggccc tcctggacta cctcttcctg caccgggaag acccggaggt gcgcccgctg      1020
     ctggggcgcg gcgaggcgga cggcgcgtcc gccggccccc cgcgcccggg cgattcggcg      1080
     cgcctggaga aggcggtgga gcggcacgaa ggcccggcct ccggccgcct ggccaggcgc      1140
     ctgctctccc ggggctcgct ggaggtcgcg atctaccggg accccgcggg gcgccccgcg      1200
     ggcttcgccg cgagcctgcg gctgcggcgg gccggcggtg aggagcggga cccggccgcg      1260
     ctcgcagccc tgcggcacct ggagggccgg gggccgctca ggacgggcga ggaggccgcg      1320
     ctcctccgct tctggatggc gcgctcctcc taccagagcg ggccggccct gcggggcatc      1380
     ctactcgacg ccgtactccg gcacgtcctc gacgcccctc ccccggcatg cacgctcctc      1440
     gtcgtcgcag accccccgcg cagcggccgg gcgctcgaca ggctgggctt tccccgcctg      1500
     ccgggggaag gcttcgcggt cggcggcaga cgctacgccc tctacggcca cgactggagg      1560
     acggtccctc ccggggactg gctggacctc ctggcggagc gcggccccgc cggggaggcg      1620
     ctcgccgggc cggcaggcga gcgccccgcc gtcctggaga gggaggagtt cgcctccgcc      1680
     gtgcgggagg ccctgaagaa ccacgcccgg ccgggagcgc tcgcgtccag ccccctcctc      1740
     cgctcccggc tggtcgcccg gcggaccggg ggcggctcgg gagagaggga gcgggtggcc      1800
     gccctgcggg ccctgctcga ggaggcggcg gagacgctcc ggcagcaccc gcgcgacgcc      1860
     aggctctacc gggcgctgca ccacacctac ttccggccgg cgcccaccca ggagcaggcg      1920
     gcgaggctcc tgggcctgcc cttcagcacc taccgcaggc acctcagggc cggcatagag      1980
     aacgtcacgg acctcctctg gcgacaggaa acccaccctc ccgcaaaacc ggacagaaag      2040
     tga                                                                    2043
//

If you have problems or comments...

PBIL Back to PBIL home page