(data stored in ACNUC7421 zone)

EMBL: CP000386.PE424

CP000386.PE424       Location/Qualifiers
FT   CDS_pept        463575..463829
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03405"
FT                   /db_xref="GOA:Q1AYX3"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX3"
FT                   /protein_id="ABG03405.1"
FT                   /translation="MLPRERGSRRAEEAFPERRFSGLSEEQKITWDPEADRRIKRSPFL
FT                   MRRFIRKRIEDRVRSRGRTRVTEADVDESARMYRQYRFK"
     atgttgcccc gagagcgggg ctcccgccgt gcagaggagg ctttccccga gaggaggttt        60
     tccggtttgt ccgaggagca gaagatcacc tgggaccctg aggcggaccg ccggataaag       120
     cgcagcccct tcctgatgcg ccgctttatc cgcaagcgga tagaggaccg ggtccgctcc       180
     cgggggcgca cccgcgtcac cgaggcggac gtggacgaga gcgcccggat gtaccgccag       240
     taccgcttca agtag                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page