(data stored in ACNUC7421 zone)

EMBL: CP000386.PE425

CP000386.PE425       Location/Qualifiers
FT   CDS_pept        463834..464193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0432"
FT                   /product="protein of unknown function DUF498"
FT                   /note="PFAM: protein of unknown function DUF498; KEGG:
FT                   bta:533224 hypothetical LOC533224"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03406"
FT                   /db_xref="InterPro:IPR007523"
FT                   /db_xref="InterPro:IPR034096"
FT                   /db_xref="InterPro:IPR036748"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX2"
FT                   /protein_id="ABG03406.1"
FT                   /translation="MGSPRITGLSWGRLETERGAFKDAKLYPGGAREWDWNETGTRHDP
FT                   GIQPADVAELLERGAEVVVLGRGFYGRLGVCEETLRLLRERGVEVYAERTEEAVRRYNG
FT                   LAPERRAGALIHSTC"
     atgggctcgc cccggatcac cgggctctcc tgggggcggc tggagaccga gcggggcgcc        60
     ttcaaggacg ccaagctcta ccccggcggg gcccgcgagt gggactggaa cgagacgggc       120
     acccggcacg accccggcat acagcccgcc gacgtcgcgg agcttctgga gcgcggcgcg       180
     gaggtggttg tcctcggccg cggcttttac gggcgcctgg gggtctgcga ggagacgctg       240
     cggctgctgc gggagcgggg ggtggaggtg tacgcggagc ggaccgagga ggccgtccgc       300
     cgctacaacg ggctggcccc ggagcgaagg gcgggggcgc tcatccactc cacctgctag       360
//

If you have problems or comments...

PBIL Back to PBIL home page