(data stored in ACNUC7421 zone)

EMBL: CP000386.PE427

CP000386.PE427       Location/Qualifiers
FT   CDS_pept        464930..465442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0434"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03408"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYX0"
FT                   /protein_id="ABG03408.1"
FT                   /translation="MTNARTLPGALPLLAAALLALALAVALAASGERAAAAEKAPRYTV
FT                   LSVSDAPGVREVVVSTAARREEGLRLVADELREKGNVPEDGTLLVEYRKRRDPSRETGF
FT                   ALVFDSERAVLEAGKTARYGEVYDEEDAEQIMEEEGGIRAVSYRDFAEENPGLWERIRG
FT                   FLLPVLS"
     ttgaccaacg ccagaaccct gcccggggcc ctgccgctcc tggctgcggc actgctcgcg        60
     ctggccctgg cggttgcgct cgcggcctcc ggggagaggg ccgcggcggc cgagaaggcg       120
     ccgcggtaca ccgtcctgag cgtctccgac gcgccggggg tgcgggaggt cgtcgtctcc       180
     accgccgccc ggcgggagga ggggctgcgc ctcgtcgctg acgagctgcg cgagaagggg       240
     aacgtgcccg aggacgggac cctgctcgtc gagtaccgca agcgccggga tccctcccgg       300
     gagacgggct tcgccctcgt cttcgacagc gagcgcgcgg tgctcgaggc ggggaagacc       360
     gctcgctacg gcgaggtcta cgacgaggag gacgccgagc agataatgga ggaggagggc       420
     ggcatccggg ccgtcagcta ccgggacttc gccgaggaga accccggcct ctgggagcgc       480
     atccggggct ttctcctccc ggttctctcc tag                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page