(data stored in ACNUC7421 zone)

EMBL: CP000386.PE429

CP000386.PE429       Location/Qualifiers
FT   CDS_pept        complement(465816..468224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0436"
FT                   /product="UspA"
FT                   /note="PFAM: Rubredoxin-type Fe(Cys)4 protein UspA; KEGG:
FT                   mma:MM1452 universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03410"
FT                   /db_xref="GOA:Q1AYW8"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW8"
FT                   /protein_id="ABG03410.1"
FT                   /translation="MSERTMSGAPRGAPRAGGILASSKARGDMYKEVYVPVDNSDYSNQ
FT                   ACVIGVDVARAFGGRVAGCHAYAAKMHDVRFRQMESGLPEEFRDEEEMQRQRKIHDQLI
FT                   TKGLEIITDSYIDVLEPLCEKYDVELVRRSLEGKNFKVIVEDVNSGDYDLVVMGAMGMA
FT                   AVKDTVLGSVTERVTRRLKKADCLIVKDLDRSPFEHIVVTIDGSAKSLGGLKRAIDLAR
FT                   EFGGTVEAISVFDPYFHYAMFHSIAGVLSTKAQKVFRFKEQEKLHEEIIDSGLAKIYTA
FT                   HLEVAKKVAADEGVELKTTLLAGKPFEQTLKYVREVEPSLVVMGRIGYHSDEDMDIGSN
FT                   TENMMRYLPTNVLVVNYEYQAPDLYTAEEHITWTKEALERMDRVPGFVVGMASGAVIRY
FT                   AIEKGYTVITTSVIDEVIENILPPGAMESMRAIGDQIRAQEAAGEEAPVDSLFKDFEER
FT                   TRQNGSSNGHRNGTSDPEKEAKREIIEGGRGGFGKAEDQGDVEGISEEVQEEIQRAAQG
FT                   RDRFECDVCRYVAKGKPARCPVCGAGPTHFHPVDAEIATAAAGENLNRSEVYDGRELHW
FT                   TDEAQAFLDSLEGWQEKRRVKARAEKSALKKGYTTITREYVEQQYREETGREAPETKRG
FT                   GGCPVHQAKEKVERETGGKCPIDHRAFKEAGRRVPEGGSGEFAWTEDAVARLERVPKGF
FT                   MRNISRNMTEKLARKKGVREIDMPLIEEALEGARNTMEDVITGKISIAELARDTGEKIE
FT                   AGENGEAPHPNLTVTMVCTTCGEEMEGIQPPEECPVCGAPAEDFEQKGR"
     gtgagcgagc ggacgatgag cggggcgccg cgcggcgccc cccgagcagg cgggatcttg        60
     gcgtctagca aggctagggg agatatgtac aaagaggtct acgtcccggt cgacaactcg       120
     gactactcca accaggcgtg cgtcatcggg gtcgacgtgg cccgcgcgtt cggcggtcgg       180
     gtggccggct gccacgccta cgccgccaag atgcacgacg tgcgcttccg ccagatggag       240
     agcgggctcc ccgaggagtt ccgcgacgag gaagagatgc agcggcagcg caagatccac       300
     gaccagctca tcaccaaggg cctcgagatc atcaccgact cctacatcga cgtgctcgag       360
     cccctgtgcg agaagtacga cgtggagctc gtgcgccgct cgctggaggg caagaacttc       420
     aaggtcatcg tcgaggacgt caactccggc gactacgacc tcgtggtgat gggcgcgatg       480
     gggatggccg cggtcaagga caccgtgctc ggctcggtaa ccgagcgggt cacccggcgc       540
     ctcaagaagg ccgactgcct gatcgtcaag gacctcgacc gcagcccctt cgagcacatc       600
     gtcgtcacca tcgacggcag cgccaagtcg ctcggcgggc tcaagagggc gatagacctg       660
     gcgcgggagt tcggggggac cgtcgaggcc ataagcgtct tcgacccgta cttccactac       720
     gccatgttcc actccatagc gggggtcctc tcgaccaagg cgcagaaggt cttccgcttc       780
     aaggagcagg agaagctgca cgaggagatc atcgactccg ggctcgccaa gatctacacc       840
     gcccacctgg aggtggccaa gaaggtcgcc gccgacgagg gggtggagct caagaccacg       900
     ctgctcgcgg gcaagccctt cgagcagacg ctgaagtacg tgagggaggt ggagccctcg       960
     ctggtggtga tggggcgcat cggctaccac tccgacgagg acatggacat cggctccaac      1020
     acggagaaca tgatgcgcta cctgccgacc aacgtcctcg tggtcaacta cgagtaccag      1080
     gccccggacc tctacaccgc cgaggagcac atcacctgga ccaaggaggc cctggagagg      1140
     atggaccggg tgccgggctt cgtcgtgggg atggcctcgg gcgcggtgat ccggtacgcc      1200
     atcgagaagg gctacacggt gatcaccacg agcgtgatcg acgaggtgat agagaacatc      1260
     ctcccgcccg gggcgatgga gtccatgcgc gccatcggcg accagatccg cgcgcaggag      1320
     gctgccggcg aggaggctcc ggtggactcg ctgttcaagg acttcgagga gcgcaccagg      1380
     cagaacggct cctccaacgg ccaccgcaac ggcacctccg acccggagaa ggaggcgaag      1440
     cgggagatca tcgagggcgg ccgcggcggc ttcgggaagg ccgaggacca gggcgacgtg      1500
     gagggtatct ccgaggaggt gcaggaggag atccagcgcg ccgcccaggg ccgcgaccgc      1560
     ttcgagtgcg acgtctgccg ctacgtggcg aagggcaagc ccgcccgctg cccggtctgc      1620
     ggcgccgggc ccacccactt ccacccggtg gacgccgaga tcgcaaccgc cgccgcgggc      1680
     gagaacctca accgctcgga ggtctacgac ggccgcgagc tgcactggac cgacgaggcg      1740
     caggcgttcc tggactccct ggaggggtgg caggagaagc ggcgcgtgaa ggcgcgcgcg      1800
     gagaagagcg cgctgaagaa gggctacacc acgatcacgc gcgagtacgt cgagcagcag      1860
     taccgggagg agaccggccg cgaggccccc gagacgaaga ggggcggcgg ctgcccggtc      1920
     caccaggcca aggagaaggt ggagcgcgag accggcggca agtgccccat cgaccaccgg      1980
     gccttcaagg aggccggcag gcgggtcccc gaggggggct ccggcgagtt cgcctggacc      2040
     gaggacgcgg tggcgcgtct cgagcgggtg cccaagggct tcatgcgcaa catctcgcgc      2100
     aacatgaccg agaagctggc gcgaaagaag ggcgtcaggg agatcgacat gcccctcatc      2160
     gaggaggcgc tcgagggggc ccggaacacg atggaggacg tgatcacggg caagatctcg      2220
     atcgccgagc tggcccgcga cacgggcgag aagatcgagg ccggcgagaa cggcgaggcg      2280
     ccgcacccca acctcaccgt gacgatggtc tgcacgacct gcggcgagga gatggagggc      2340
     atccagcccc ccgaggagtg cccggtctgc ggcgctccgg ccgaggactt cgagcagaag      2400
     gggcgctag                                                              2409
//

If you have problems or comments...

PBIL Back to PBIL home page