(data stored in ACNUC7421 zone)

EMBL: CP000386.PE433

CP000386.PE433       Location/Qualifiers
FT   CDS_pept        complement(471349..471972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0440"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein, TetR; KEGG: sth:STH2255
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03414"
FT                   /db_xref="GOA:Q1AYW4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW4"
FT                   /protein_id="ABG03414.1"
FT                   /translation="MGEERDRRDQILEAAFEEFSAKGFRGATIKSIAEAAGLQSPALIY
FT                   WYFPDKEALFREVLGSRIPVLRAVRDPARLLERPPEEVLPLIARRYLSTFDNPAAQRMA
FT                   RLLVGEATRRPEIAEIFGNAVIKRMLGFLKSYMARQVELGRLRPHDVRSSARAFIGMLL
FT                   PQVGGKVFFPAIREDGLTDEEHVENAVGMLLEGLRPEGKQGWTP"
     ttgggagagg agcgggacag gcgggaccag atcctggagg cggccttcga ggagttctcg        60
     gcgaaggggt ttcggggggc gacgataaag agcatcgcgg aggcggcggg gctgcagtct       120
     ccggccctga tctactggta cttcccggac aaggaggcgc tcttcaggga ggtcttgggg       180
     tcgcgcatcc cggtgctgcg cgcggtgcgg gacccggcgc ggctgctgga gcgtccgccc       240
     gaggaggtgc tgccgctcat agcgaggagg tacctctcca ccttcgacaa cccggcggcc       300
     cagaggatgg cgcggttgct ggtcggcgag gccacgcggc ggcccgagat cgcggagatc       360
     ttcggcaacg ccgtcataaa gaggatgctc gggttcctca agagctacat ggcccgccag       420
     gtcgagctcg gcaggctccg cccgcacgac gtccgctcca gcgcgcgggc ctttatcggg       480
     atgctgctgc cccaggtcgg gggcaaggtc ttcttccccg cgataaggga ggacggcctc       540
     accgacgaag agcacgtgga gaacgcggtc gggatgctgc tggaagggct gaggccggaa       600
     gggaagcagg gatggacgcc gtag                                              624
//

If you have problems or comments...

PBIL Back to PBIL home page