(data stored in ACNUC7421 zone)

EMBL: CP000386.PE434

CP000386.PE434       Location/Qualifiers
FT   CDS_pept        472116..474092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0441"
FT                   /product="Amylo-alpha-1,6-glucosidase"
FT                   /note="PFAM: Amylo-alpha-1,6-glucosidase; KEGG: sco:SCO7493
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03415"
FT                   /db_xref="GOA:Q1AYW3"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW3"
FT                   /protein_id="ABG03415.1"
FT                   /translation="MQLPDRETETLEWAVSVVSPGAYAVSDGAGDFDAGAGGLYYRDTR
FT                   HLSRFVLEVGGERPVVRGREARGTAAEFLLEAAGLELVRRRRLGHGMEEEVEVRNPSGR
FT                   AVEARLSFGVGADFEDVFVVRGFAGRAERGEVVEEVREGGLRYLYRRGGFSRGTEVRAF
FT                   AEGAEPVAGSGGIHCLLRLGAGQRRVVRVSVALEEGGERVRAAGRRGAPYAAAPALETD
FT                   WEALRRSWERSVEDLAALTFDAGEGLLVPAAGAPWYMALFGRDALLAAYGAMILTPEPA
FT                   RNALRALARWQATERDDYTDAEPGKIPHELRRGELAYFREVPQPYYGTADATPLFLVLL
FT                   EEHRRWTADEGLARELEGAARRALDWLLAHADRTSGGFVAYESRSPAGLRNHGWKDSDG
FT                   SMLFRDGRRAGGGVAPCEVQGYAYDALLRTARLAESAWGDAALAGRLRDEAGDLRERFD
FT                   RDYWMEDRGCYALALDGEGRKVDSVTSNAGHLLWSGIVPEEKAPLLARRLLSEEMFSGW
FT                   GIRTMAEGEGGYDPLSYHNGSVWPHDSALIALGLARYGFRKEAARVAAALVEAAERFGY
FT                   RLPEVFGGERRREGEGPAGYPSSCSPQAWAAAAVPLLVRALLGAEPDPEARVLRSGPVL
FT                   PEGVRGLRLEGVPAFGGRHAVGG"
     ttgcagttgc cggaccggga gacggagacg ctggagtggg cggtgagcgt ggtctcgccc        60
     ggggcctacg ccgtctcgga cggggcgggg gacttcgacg ccggggccgg ggggctctac       120
     taccgggaca cgcggcacct ctcgcggttc gtgctggagg tggggggaga gaggccggtg       180
     gtgcgggggc gcgaggcgcg ggggacggcg gcggagttcc tgttggaggc ggcggggctc       240
     gagctggtgc ggcggcgccg gctcgggcac gggatggagg aggaggtcga ggtgcgcaac       300
     ccctccggga gggcggtcga ggcacgcctc tcgttcgggg tgggcgcgga cttcgaggac       360
     gtcttcgtgg tgcgcggctt cgcggggagg gcggagcgcg gggaggtcgt ggaggaggtc       420
     cgggaggggg gactgcgcta cctctaccgg cggggcgggt tctcgcgggg gacggaggtg       480
     cgcgccttcg cggagggggc ggagccggtc gcggggagcg gggggatcca ctgcctcctg       540
     cggctcgggg cggggcagag gcgggtggtg cgcgtctcgg tggcgctcga ggagggcggg       600
     gagagggtgc gcgctgcggg gcggcgcggg gcgccgtatg ccgcggcgcc ggcgctcgag       660
     acggattggg aggcgctgcg gaggagctgg gagcggagcg tcgaggacct cgcggcgctc       720
     accttcgacg cgggggaggg attgctcgtc ccggcggccg gggcgccgtg gtacatggcc       780
     ctcttcgggc gggacgcgct cctcgcggcg tacggggcca tgatcctcac ccccgagccg       840
     gcgcgtaacg cgctgcgggc gctcgcccgg tggcaggcga ccgagcggga cgactacacc       900
     gacgccgagc ccggcaagat cccgcacgag ctccggcgcg gggagctggc gtacttccgg       960
     gaggtcccgc agccctacta cggcaccgcc gacgccaccc cgctcttcct cgtcctgctc      1020
     gaggagcacc ggcgctggac cgccgacgag gggctcgcgc gcgagctgga gggcgcggcc      1080
     cgccgggcgc tggactggct cctcgcccac gccgacagga cctccggggg attcgtcgcc      1140
     tacgagagcc gctcccccgc gggcctcagg aaccacggct ggaaggactc ggacggctcc      1200
     atgctcttcc gcgacgggag gcgcgcaggg ggcggggtgg ccccctgcga ggtccagggc      1260
     tacgcctacg acgccctcct ccgcaccgcg cgcctcgccg agagcgcctg gggcgacgcg      1320
     gcgctcgccg gaaggctccg ggacgaggcc ggggacctga gagagcgctt cgaccgcgac      1380
     tactggatgg aggaccgcgg ctgctacgcc ctcgccctcg acggggaggg acgaaaggtc      1440
     gactccgtga cctccaacgc cgggcacctg ctctggagcg gcatcgtgcc ggaggagaag      1500
     gcccctctcc tcgcgcggcg gctgctctcg gaggagatgt tctccggctg gggcataagg      1560
     acgatggccg aaggagaggg cggctacgac cccctctcct accacaacgg ctccgtctgg      1620
     ccccacgaca gcgccctcat cgccctgggt ctcgcccgct acggtttccg gaaggaggcg      1680
     gcacgcgtcg cggccgcgct cgtcgaggct gcggagcgct tcgggtaccg cctgcccgag      1740
     gtcttcgggg gggagcggcg gagggagggg gagggcccgg ccgggtaccc gtcctcctgc      1800
     agcccgcagg cgtgggccgc ggccgcggtg ccgctcctcg tgcgcgccct cctcggggcc      1860
     gagcccgacc cggaggcgcg ggtactgcgc tcgggcccgg tgttgcccga gggcgtccgc      1920
     gggctgcgcc tcgagggcgt cccggccttc ggcgggcggc acgcggtcgg ggggtga         1977
//

If you have problems or comments...

PBIL Back to PBIL home page