(data stored in ACNUC7421 zone)

EMBL: CP000386.PE435

CP000386.PE435       Location/Qualifiers
FT   CDS_pept        474125..474370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0442"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03416"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW2"
FT                   /protein_id="ABG03416.1"
FT                   /translation="MVSLPCSLEEKGACSHVVDRKDLILLESAIDAIEEAASAVAQEIE
FT                   RDRLGETSLARLATVEAELNRSRLALEEIVREESGG"
     gtggtctctc tgccgtgctc tctcgaggag aaaggagcgt gctcacacgt ggtggacaga        60
     aaagacctca tcctcctgga gagcgccatc gacgccatag aggaggccgc ctccgcggta       120
     gcccaggaga tagagcgcga ccggctcggc gagaccagcc tggcgcgcct cgccacggtg       180
     gaggccgagc tcaaccgcag ccggctggcg ctcgaggaga tcgtgcggga ggagtcgggg       240
     ggctag                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page