(data stored in ACNUC7421 zone)

EMBL: CP000386.PE436

CP000386.PE436       Location/Qualifiers
FT   CDS_pept        complement(474375..475544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0443"
FT                   /product="peptidase S1 and S6, chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6, chymotrypsin/Hap Colicin
FT                   V production protein; KEGG: fra:Francci3_4292 colicin V
FT                   production protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03417"
FT                   /db_xref="GOA:Q1AYW1"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYW1"
FT                   /protein_id="ABG03417.1"
FT                   /translation="MWVRIARMTALDWCIVAFVALAVFRGARTGFLAGLFSLVGVLLGA
FT                   SVGSRVAGHLIPEGESPFLGAAITLVSIVSFAILGEMIARSAGGSLRSRLRGGGSSLLD
FT                   SAGGAALGLALSLLLVWAVGIFAIQSPPLSGLHPLVKDSRIIRALDERMPAELLTQAVA
FT                   QLNPLPQMRGPDAGVGAPDGSIVRDPDVLAASSRMVRITGIACGYGIEGSGWVAAPDLI
FT                   VTNAHVVAGETVTSVQPGGTGPRRRADVVVFDPKNDVAVLRVEDLGLTPLPLDEPVPGE
FT                   PAAVLGFPGNGPLDIQPARTGATQRVISSDAYNRGPVERTVTSFRVYVRPGNSGGPVVN
FT                   AEGEVTATIFASRANSRNSGYGIPSQIIRRHLERATLRAEPVGTGPCAS"
     atgtgggtta gaattgcccg gatgacggcg ctcgactggt gcatagttgc gttcgtggcg        60
     ctggccgtct ttcgcggcgc ccggaccggc tttctcgcgg gcctcttctc gctggtgggg       120
     gtgctgctgg gggcctcggt cggctcccgg gtggccgggc acctcatccc ggagggcgag       180
     agcccctttc tgggggccgc gatcacgctg gtgagcatag tctccttcgc gatcctcggc       240
     gagatgatcg cccgctcggc cgggggctcg ctccgcagca ggctccgggg cggcggctcc       300
     tccctgctcg acagcgccgg cggggccgcc ctcgggctgg cgctctccct gctgctggtg       360
     tgggcggtcg ggatcttcgc catccagtcc cccccgctct ccgggctgca cccgctggtg       420
     aaggactcgc gcatcatccg cgcgctcgac gagcggatgc ccgccgagct cctcacccag       480
     gccgtcgccc agctcaaccc gctcccccag atgcgcggcc ccgacgccgg ggtgggggcg       540
     cccgacggga gcatcgtccg cgaccccgac gtgctcgccg caagctcccg gatggtccgg       600
     atcacgggca tcgcctgcgg ctacggcatc gagggctccg ggtgggtcgc cgctccggac       660
     ctgatcgtca ccaacgccca cgtggtcgcc ggggagaccg tcaccagcgt ccagcccggg       720
     gggaccgggc cgcgccggag ggccgacgtg gtggtcttcg accccaagaa cgacgtggcc       780
     gtcctgcggg tggaggacct ggggctcacc cccctgccgc tggacgagcc ggtccccgga       840
     gagcccgcgg cggtcctcgg cttccccggc aacgggccgc tggacatcca gcccgcccgc       900
     accggggcca cgcagcgcgt gatctccagc gacgcctaca accgcggccc ggtggagcgc       960
     acggtcacca gcttccgggt ctacgtccgg ccggggaact ccggggggcc ggtggtgaac      1020
     gccgagggcg aggtgaccgc caccatcttc gccagccggg ccaactcccg caactccggc      1080
     tacgggatcc cctcccagat catccgccgc cacctggaga gggccaccct ccgcgcggag      1140
     ccggtgggca cgggtccctg cgcgagctga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page