(data stored in ACNUC7421 zone)

EMBL: CP000386.PE44

CP000386.PE44        Location/Qualifiers
FT   CDS_pept        45190..46065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0044"
FT                   /product="beta-lactamase-like protein"
FT                   /note="PFAM: beta-lactamase-like; KEGG: mta:Moth_1254
FT                   beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03025"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B003"
FT                   /protein_id="ABG03025.1"
FT                   /translation="MRRRALAPALVLVLLLFAACGGVRGGAGPPPSGALSVSFIDVGQG
FT                   DSVLVQAGGEDYLVDAGNPEEGPVVVDFLRERGVDDLEGLVSTSGDADHAGGLADVLEA
FT                   FPVERIYLSGYPKDTLTYAGFLRAVRAEEGADVERVRAGYRTEWGGVRVDVLNPPPGGY
FT                   FSGSNDNSVAVLLTYGRARVLLAGDAERRAEEYMAGGPHTGPLTVLKVNHHGSETSSGP
FT                   LFLSRFRPKVAVIQCGRDNPYGHPDPEVLERLRRVGARVFRTDLHGDVIVTIRRDLVEV
FT                   AVERPARAGA"
     gtgaggcgcc gcgctctggc ccccgcgctg gtgctcgtcc tgctcctctt cgccgcctgc        60
     ggcggggtcc ggggcggcgc cgggccgccg ccgtccgggg cgctctcggt gagcttcata       120
     gacgtggggc agggggactc cgtgctcgtg caggccggcg gggaggacta cctggtggac       180
     gccggaaacc ccgaggaggg gccggtcgtg gtggatttcc tgcgggagcg gggcgtggac       240
     gacctggagg ggctcgtctc caccagcggg gacgccgacc acgccggggg gctcgccgac       300
     gtgctcgagg ccttcccggt cgagaggatc tacctctccg gctaccccaa ggacaccctc       360
     acctacgcgg gctttctgcg ggccgtccgg gccgaggagg gggccgacgt cgagcgggtg       420
     cgggcggggt acaggacgga gtggggcggg gtgagggtag acgtgctcaa cccgccgccc       480
     ggcggctact tctccggctc caacgacaac tccgtggcgg tgctgctgac ctacgggagg       540
     gcccgcgtcc tgctcgcggg ggacgccgag cggcgggccg aggagtacat ggcgggcggg       600
     ccccacaccg gcccgctcac cgtcctcaag gtaaaccacc acgggtccga gacctcctcc       660
     ggcccgctct ttctcagccg cttcaggccg aaggtcgccg tgatacagtg cgggcgggac       720
     aacccctacg ggcacccgga cccggaggtg ctggagcgcc tgcgccgggt cggggccagg       780
     gtcttcagga ccgacctgca cggggacgtg atcgtcacca tccgccgcga cctcgtggag       840
     gtggcggtcg agaggccggc gcgggccggg gcctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page