(data stored in ACNUC7421 zone)

EMBL: CP000386.PE443

CP000386.PE443       Location/Qualifiers
FT   CDS_pept        complement(483675..484454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0450"
FT                   /product="biotin/lipoate A/B protein ligase"
FT                   /note="PFAM: biotin/lipoate A/B protein ligase; KEGG:
FT                   bbr:BB2891 putative lipoate-protein ligase A"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03424"
FT                   /db_xref="GOA:Q1AYV4"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV4"
FT                   /protein_id="ABG03424.1"
FT                   /translation="MTAERWSRYRWRLIRGEPVPPPVNHALDEVLTRRVGAGERPPTLR
FT                   FWGRFAPEVALGRFQSLGNEVDAGGVRRHGVAVVRRMTGGGAMFIEPASVITYSLYAPA
FT                   ELVAGMSAAESYPFLDAWVVEALRSLGIEAHHEPINDISSPEGKIGGSAQARAFGAVLH
FT                   HTTLAYDMDARKMLEVLRIGQEKISDKAVRSAERRVGPLRRQTRLPRERIVERMVSTFS
FT                   RYAGALEEDRVSPQEAEEAEALVRSKYGTPAWNALIP"
     atgacggcgg agcggtggtc ccgctaccgg tggcgcctga tccggggcga gccggtcccc        60
     ccgccggtca accacgccct cgacgaggtg ctcacccggc gcgtcggcgc cggggagcgc       120
     ccgcccaccc tgcgcttctg ggggcgcttc gcgccggagg tcgccctcgg caggttccag       180
     tcgctgggca acgaggtgga cgccgggggc gtccgccggc acggggtcgc cgtcgtgcgc       240
     cggatgaccg gcggcggcgc gatgttcata gagcccgcca gcgtcatcac ctactcgctc       300
     tacgcgccgg cggagctcgt cgccgggatg agcgcggcgg agtcctaccc ctttctcgac       360
     gcctgggtcg tcgaggccct gcgctccctg gggatagagg cccaccacga gcccatcaac       420
     gacatctcct ccccggaggg caagatcggg ggctccgccc aggcgcgcgc cttcggcgcg       480
     gtgctccacc acaccaccct cgcctacgac atggacgcca gaaagatgct ggaggtgctg       540
     cgcatcgggc aggagaagat cagcgacaag gccgtacgga gcgccgagag gcgggtgggg       600
     ccgctgcggc gccagacccg gctgccgcgg gagaggatag tcgagcggat ggtctcgacg       660
     ttctcccgct acgcgggcgc cctggaggag gaccgcgtct caccgcagga ggccgaggag       720
     gccgaagcgc tcgtgcgctc caagtacggc accccggcct ggaacgcgct catcccctga       780
//

If you have problems or comments...

PBIL Back to PBIL home page