(data stored in ACNUC7421 zone)

EMBL: CP000386.PE444

CP000386.PE444       Location/Qualifiers
FT   CDS_pept        complement(484451..484729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bbr:BB2890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03425"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV3"
FT                   /protein_id="ABG03425.1"
FT                   /translation="MHGEYKTPGGKLVAADLEVAGDRLRSVRISGDFFLEPPEALESIS
FT                   GALEGASAAASEEELAALVSGALPRGTEMVGFSPQAVARAVRRALSR"
     gtgcacgggg agtacaagac cccgggcggg aagctggtcg ccgcggacct ggaggtcgcc        60
     ggggaccggc tgcggtcggt gaggatcagc ggcgacttct ttctggagcc ccccgaggcg       120
     ctggagagca tctcgggggc gctggagggc gcctccgccg cggcgagcga ggaggagctc       180
     gccgccctgg tgagcggggc cctcccccgg gggaccgaga tggtgggctt ctcgccgcag       240
     gcggtggccc gcgcggtgcg gagggccctc tcccgatga                              279
//

If you have problems or comments...

PBIL Back to PBIL home page