(data stored in ACNUC7421 zone)

EMBL: CP000386.PE446

CP000386.PE446       Location/Qualifiers
FT   CDS_pept        complement(486788..487906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03427"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYV1"
FT                   /protein_id="ABG03427.1"
FT                   /translation="MLPGGTAREFVDRIGRALELAEERGIRPVAGSGPVDLEAEELAPA
FT                   GEAGGAPGEARHLESPPGARDPGRPDGRSRLRYFLDGVQSTREICRIGAAPVVATTVAA
FT                   AIAERSGRRLARMRFDGPPELVRAVILPVEAGDERIAELRDLLVQTGLEPLGYEEAPGS
FT                   PWHVLSSTEHVPAPDPSDYAGLRALAFGRARTLRERLETELLRRWEEDDRVLDNDDWLA
FT                   ADGQLGRPSPRAVGLVKSVARPEFGGAEAELLLDLAPGMRTTSFIPGWQVRRAVTDQRA
FT                   SWYVRCWPPQPGAGALGSLMRVEAARGTDPRMADEITRWILAERAPLAKPDPRWPAMIY
FT                   PIHHVERTLKPAVQGSERAYLRLQRQLRQHGR"
     atgctgccgg gagggacggc cagggagttc gtggaccgga tcgggcgggc gctggagctg        60
     gccgaggagc gcggcataag gccggtggcg ggttcggggc ccgtggacct cgaggccgag       120
     gagctcgcgc cggccgggga ggccggggga gcgccgggcg aggcgcggca cctggagagc       180
     ccgcccgggg cgagggaccc cggccggccg gacgggcgct cgcggctgcg gtactttctc       240
     gacggggtcc agagcacccg cgagatctgc cgcatcgggg cggcgccggt ggtggcgacc       300
     acggtggccg cggcgatcgc cgagcgcagc gggcggcgcc tcgcccggat gcgcttcgac       360
     ggccccccgg agctggtccg cgccgtgatc ctgcccgtcg aggcgggcga cgagcggata       420
     gccgagctgc gcgacctcct ggtgcagacc gggctcgagc cgctcggcta cgaggaggcg       480
     cccggctccc cgtggcacgt gctcagctcc accgagcacg tgcccgcccc agacccctcg       540
     gactacgcgg ggctgcgggc gctcgccttc gggcgggcgc gcaccctgcg cgagcgcctg       600
     gagaccgagc tgctgcggcg gtgggaggag gacgaccggg tgctggacaa cgacgactgg       660
     ctggccgccg acgggcagct cgggaggccc tccccccggg ccgtcggcct cgtaaagagc       720
     gtggcccgcc cggagttcgg gggggcggag gccgagctgc tgctggacct ggccccgggc       780
     atgcgcacca ccagcttcat ccccggctgg caggtccggc gggcggttac cgaccagcgg       840
     gcctcctggt acgtgcggtg ctggcccccg cagccggggg cgggggcgct cgggtcgctc       900
     atgcgggtcg aggccgcccg cggcacggac ccccggatgg ccgacgagat cacgcgctgg       960
     atcctggccg agcgggcgcc gctggcgaag cccgaccccc ggtggccggc catgatctac      1020
     cccatccacc acgtcgagag aaccctcaag cccgcggtgc agggttccga gagggcctac      1080
     ctgcgcctgc agaggcagct tcggcaacac gggaggtga                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page