(data stored in ACNUC7421 zone)

EMBL: CP000386.PE45

CP000386.PE45        Location/Qualifiers
FT   CDS_pept        46145..46570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0045"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: tde:TDE1677 single-strand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03026"
FT                   /db_xref="GOA:Q1B002"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:Q1B002"
FT                   /protein_id="ABG03026.1"
FT                   /translation="MVSFNRVILAGNLTRDPELRFTSDGVPVCSFGIAVNRVRSRNEEV
FT                   DFFDVSAWRELGETIANYKKKGDPILIEGRLQYRTWEAQDGTRRSKVDIVADNVQFLGR
FT                   GGDPGEGGGSSGGQGRRGRGAGDEVDINESDFDDIPF"
     atggtcagct tcaaccgggt gatactcgcg ggcaacctca cgcgggaccc cgagctcagg        60
     ttcaccagcg acggggtgcc ggtgtgctcc ttcggcatag cggtaaaccg ggtgcgctcc       120
     aggaacgagg aggtggactt cttcgacgtc tcggcctggc gcgagctcgg cgagaccatc       180
     gccaactaca agaagaaggg cgacccgatc ctgatcgagg gtcgcctgca gtaccggacc       240
     tgggaggccc aggacggcac gcggcgctcg aaggtggaca tcgtggcgga caacgtccag       300
     ttcctcgggc gcggcggaga cccgggcgag gggggtggct cctccggcgg ccagggccgg       360
     cgcgggcgcg gcgccggcga cgaggtggac atcaacgagt cggacttcga cgacatcccc       420
     ttctag                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page