(data stored in ACNUC7421 zone)

EMBL: CP000386.PE453

CP000386.PE453       Location/Qualifiers
FT   CDS_pept        complement(492878..494386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0460"
FT                   /product="permease for cytosine/purines, uracil, thiamine,
FT                   allantoin"
FT                   /note="PFAM: permease for cytosine/purines, uracil,
FT                   thiamine, allantoin; KEGG: bja:bll3347 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03434"
FT                   /db_xref="GOA:Q1AYU4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYU4"
FT                   /protein_id="ABG03434.1"
FT                   /translation="MSGHHEVEEVLEHEREELEEAIHIEKHNSIEPVPEEYKDAKPLHQ
FT                   FWIWAGANIAPINWVLGALGIVLGLGLWETVLTLAVGNLLGMLLFGSFVLMGQRTGVTQ
FT                   MVLSRSAFGRRGAYLPAIFQIIIPTGWIAINTWIILDLTATLLELLGIPGTALTKVIVV
FT                   LVIMATQVGLATLGFYAIRSFEKWTVPPTLLILVAMSVVAWTGGDVNWSFAGEAEGAER
FT                   WTAMSQVMTAIGIGWGIGWLPYASDYSRFVPRATSRKRLFWASALGQFVPVLWLGLLGA
FT                   SIATTGTGVDPGLVIVQIFGALAIPVLFLVVHGPIATNILNVYSMSVAALAVDIKIPRH
FT                   VLSVIVGFFATLFTIYLVFAGDLAKNLDAWLASVVAWVSPWAAIMFIHYYIIRRENIDV
FT                   AALYQRPGESRVGDINWGAIACLVIGLAVTWSFLYGLVPVLQGPFARALNGLDLSWAVG
FT                   LTVTGALYYGLYRLGLVNPGGSRSGEEARQATPAEEPAQRGTGV"
     atgagcggtc atcatgaagt cgaagaagtg ctggagcacg aacgggagga gttagaagag        60
     gcgatacaca tcgagaagca caacagcatc gagcccgtcc cggaggagta caaggacgcc       120
     aagcccttgc atcagttctg gatctgggcg ggcgccaaca tcgcccccat caactgggtc       180
     ctcggggccc tggggatcgt gctcggcctc gggctctggg agaccgtact cacgctggcg       240
     gtcgggaacc tcctcgggat gctcctcttc ggatcgttcg tgctgatggg ccagcgcacc       300
     ggggtgacgc agatggtgct ctcgcgcagc gccttcgggc gccgcggcgc ctacctgccg       360
     gccatcttcc agatcatcat ccccaccggc tggatcgcga taaacacctg gatcatcctc       420
     gacctcaccg ccacgctgct cgagttgctc ggcatccccg gcacggccct caccaaggtg       480
     atcgtggtgc tggtgatcat ggcgacccag gtcgggctgg cgaccctggg cttctacgcc       540
     atccgctcgt tcgagaagtg gaccgtgccg cccacgctcc tcatcctcgt cgccatgtcg       600
     gtggtcgcgt ggaccggcgg cgacgtgaac tggagcttcg cgggcgaggc cgagggcgcg       660
     gagcgctgga ccgcgatgag ccaggtgatg accgcgatcg ggatcggctg gggcatcggc       720
     tggctcccct atgcctcgga ctactcccgc ttcgtccccc gcgccacgag ccggaagcgg       780
     ctcttctggg ccagcgccct ggggcagttc gtccccgtcc tgtggctcgg cctcctcggc       840
     gcctcaatcg ccaccaccgg cacgggggtc gacccggggc tggtcatagt gcagatcttc       900
     ggggcgctcg ccatacccgt gctgttcctg gtggtgcacg gcccgatagc caccaacatc       960
     ctcaacgtct actccatgtc ggtggcggcg ctcgccgtag acatcaagat cccccgccac      1020
     gtgctgtcgg tcatcgtcgg cttcttcgcc accctcttca ccatctacct ggtctttgcg      1080
     ggggacctcg ccaagaacct cgacgcctgg ctcgccagcg tggtggcctg ggtgagcccg      1140
     tgggcggcga tcatgttcat ccactactac atcatccggc gcgagaacat agacgtcgcg      1200
     gcgctctacc agcgtccggg cgagtcgcgg gtgggcgaca tcaactgggg ggcgatagcc      1260
     tgcctggtca tcggcctcgc cgtgacctgg tcgttcctct acggcctcgt ccccgtgctg      1320
     caggggccgt tcgcccgggc gctcaacggg ctcgacctgt cgtgggcggt ggggcttacg      1380
     gtgaccggcg cgctctacta cggcctctac cgcctcggtc tggtgaaccc cggcggctcc      1440
     aggtccggcg aggaggcccg gcaggccacg cccgccgaag aaccggccca gaggggaacg      1500
     ggggtctag                                                              1509
//

If you have problems or comments...

PBIL Back to PBIL home page