(data stored in ACNUC7421 zone)

EMBL: CP000386.PE462

CP000386.PE462       Location/Qualifiers
FT   CDS_pept        complement(504667..506091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0469"
FT                   /product="serine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase
FT                   aminotransferase class-III; KEGG: tfu:Tfu_2353 glycine
FT                   hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03443"
FT                   /db_xref="GOA:Q1AYT5"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT5"
FT                   /protein_id="ABG03443.1"
FT                   /translation="MRNDHRVSPALGDRGGAAANRRASAGGASFGLPGGYMTAPLAEVD
FT                   PEIQEVLERELERQRNTLEMIASENFVPQAVLEAVGSVLTNKYAEGYPGRRYYGGCHEV
FT                   DVAEQLAIDRAKELFGAEHVNVQPHSGAQANNAAYMALLEPGDTFLGLALDHGGHLSHG
FT                   MKLNVSGRLYNPVPYHVRREDSLVDMEEVERLANEHRPKLIVAGWSAYPRQLDFAAFRE
FT                   IADSVGAKLMVDMAHFAGLVAAGIHPNPVEYADVVTTTVHKTLAGPRSGMILCREEHAK
FT                   KIDSAVFPGQQGGPLMHVIAAKAVALRIAHTEGFRARQRQTVANAKALAEALMQNGIEV
FT                   VSGGTDVHLVLVDLTSTGLDGKTAEDRLEKVGITVNRNTIPFDPRPPMNPSGLRIGTPA
FT                   LTTRGLLEEDMREIAGIIAGALSDNFEAEHKALLERSRALMQKYPLYPDSQRPTPADGE
FT                   GKEAPAPPPPTRPSWL"
     atgaggaacg accaccgcgt ctcgcccgcg ttgggggaca gagggggggc agcggcgaac        60
     cggcgagcct ccgcgggggg agcatccttc gggctccccg gcgggtacat gacggcgccg       120
     cttgcggagg tggaccccga gatccaggag gtgctggagc gggagctcga gcgccagcgc       180
     aacaccttgg agatgatcgc ctctgagaac ttcgtgcccc aggcggtgct ggaggcggtg       240
     ggctccgtgc tgaccaacaa gtacgccgaa ggctatccgg gcaggcgcta ttacggcggc       300
     tgccacgagg tggacgtcgc cgagcagctc gccatagacc gggcgaagga gctcttcggg       360
     gccgagcacg tcaacgtcca gccccactcc ggcgcgcagg caaacaacgc cgcctacatg       420
     gcgctgctcg agcccggcga caccttcctg gggctggcgc tcgaccacgg ggggcacctc       480
     tcgcacggga tgaagctcaa cgtctccggc aggctctaca accccgtccc ctaccacgtc       540
     aggcgcgagg acagcctcgt ggacatggag gaggtcgagc gcctggcaaa cgagcacagg       600
     ccaaagctca tcgtcgccgg ctggtcggcc tacccgcgcc agctggactt cgccgccttc       660
     cgcgagatcg ccgactcggt gggcgccaag ctcatggtgg acatggccca ctttgcaggg       720
     ctcgtcgcgg cgggcatcca ccccaacccc gtcgagtacg cagacgtggt gaccaccacg       780
     gttcacaaga ccctcgccgg tccccgaagc ggcatgatcc tctgccggga ggagcacgcc       840
     aaaaagatag acagcgccgt cttccccgga cagcagggcg ggccgctcat gcacgtcatc       900
     gccgccaagg ccgtcgccct gcggatagcc cacaccgaag gcttccgcgc ccgccagcgg       960
     cagacggtcg ccaacgcaaa agcgctcgcc gaggcgctca tgcaaaacgg catagaggtg      1020
     gtctcgggcg gcaccgacgt gcacctggtg ctggtggacc tcacctcgac cggcctcgac      1080
     gggaagacgg ccgaagaccg gctggagaag gtcggcatca cggtcaaccg caacaccata      1140
     ccgttcgacc cgcgaccgcc gatgaacccc tccggcctca ggataggcac cccggcgctc      1200
     accacgcgcg gcctcctcga ggaggacatg cgcgagatcg ccgggatcat cgcgggagcc      1260
     ctgagcgaca acttcgaggc agagcataag gcgctgctcg agcgtagccg cgccctgatg      1320
     cagaagtacc cgctctaccc ggactcccag agaccaaccc cggcagacgg ggaggggaag      1380
     gaagcccccg ctccgcctcc cccaacgcgc ccatcgtggc tgtaa                      1425
//

If you have problems or comments...

PBIL Back to PBIL home page