(data stored in ACNUC7421 zone)

EMBL: CP000386.PE465

CP000386.PE465       Location/Qualifiers
FT   CDS_pept        complement(508958..509227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03446"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYT2"
FT                   /protein_id="ABG03446.1"
FT                   /translation="MCTPGSKATTVATPVASDLDLFADEVLVDPYPAYARLRELGGAVY
FT                   LPKNDAHNALLPPDAFHLPVGRPVTQKIYRDAAHPSRLALPFTT"
     atgtgtacgc cagggagtaa agccacgacc gtcgcaacgc ctgtagcctc cgacctcgac        60
     ctcttcgcag atgaggttct ggtcgacccg tacccggcat acgcccggct gcgggagctc       120
     ggaggcgccg tgtacctgcc caagaacgac gcgcacaacg ctctgttgcc gccggacgcc       180
     ttccacctcc ccgtgggccg gcccgtcacc caaaagatct accgcgacgc cgcccacccc       240
     tcccgcctcg cgctgccgtt cacgacctga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page