(data stored in ACNUC7421 zone)

EMBL: CP000386.PE472

CP000386.PE472       Location/Qualifiers
FT   CDS_pept        515506..515922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0479"
FT                   /product="protein of unknown function DUF101"
FT                   /note="PFAM: protein of unknown function DUF101; KEGG:
FT                   ttj:TTHA1745 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03453"
FT                   /db_xref="InterPro:IPR002804"
FT                   /db_xref="InterPro:IPR023572"
FT                   /db_xref="InterPro:IPR036820"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS5"
FT                   /protein_id="ABG03453.1"
FT                   /translation="MIRMLDHTADVGFEVEAPSVEGLFAEALGGLLQVMFEAPPREGGA
FT                   EERRVELSAPDLETLLVRWLNELTFLVQGEGFVPVSAEVRVGEGPSLRARLRGVPLDVE
FT                   RYGWQGEIKGATFHGLEVARRREGALHARVILDV"
     gtgatccgga tgctggacca cacggcggac gtgggcttcg aggtcgaggc tccctcggtc        60
     gagggcctgt ttgcggaggc cctcgggggg ctgctccagg tcatgttcga ggcgccgccc       120
     cgggagggcg gcgcggagga gcggagggtg gagctctcgg cgcccgacct cgagaccctg       180
     ctcgtccggt ggctcaacga gctgacgttc ctggtccagg gggagggctt cgtgcccgtc       240
     tcggcggagg tgcgggtggg ggagggaccc tcgctgcgcg cccggctgcg cggggtaccg       300
     ctcgacgtcg agcggtacgg ctggcaggga gagataaaag gggccacctt ccacggcctc       360
     gaggtggcca ggagaagaga gggagcgttg cacgcgcggg tgatactcga tgtctga          417
//

If you have problems or comments...

PBIL Back to PBIL home page