(data stored in ACNUC7421 zone)

EMBL: CP000386.PE473

CP000386.PE473       Location/Qualifiers
FT   CDS_pept        515915..517369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0480"
FT                   /product="protein of unknown function UPF0027"
FT                   /note="PFAM: protein of unknown function UPF0027; KEGG:
FT                   tth:TTC1426 RtcB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03454"
FT                   /db_xref="GOA:Q1AYS4"
FT                   /db_xref="InterPro:IPR001233"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS4"
FT                   /protein_id="ABG03454.1"
FT                   /translation="MSEKAGVADTVGFERLSEYRYRIPRQGKMRCDAVFYASRRILEDL
FT                   AAEDYASLRQLMGVATLPGIVEPALSMPDIHWGYGFPIGGVAAFDPEEGGVVSPGGVGF
FT                   DINCGVRLLVSDISREELADRKARLADELFRSVPSGVGRGRKDFRIGRPDLRRLLVEGP
FT                   SWLVERGYGEPGDLDGIESRGRLAGADPDAVSERAYQRGQPQLGTLGSGNHFLEVQYVD
FT                   EVYDEEAARAYGLHPGQVTVLIHSGSRGLGHQVCTEYVERFLQVAPKYGIELVDRQLAA
FT                   APIDSPEGRAYLGAMSAAANFAFANRQLIAHFTREAFARAGFGGRPLRVLYDLAHNNAK
FT                   LEEHGARRVLVHRKGATRAFGPGNPELPERYRGVGQPVLVPGDMGRYSFVLAGTEGSMR
FT                   ETFGSSAHGAGRKMSRRRAKKAARGRDLIREMEQVGILVRAAGRATVDEEMSEAYKDAA
FT                   EVVEVTDGAGIGKKVARLRPQIVVKG"
     atgtctgaga aggctggtgt tgctgacacc gtaggtttcg agcggctctc ggagtacagg        60
     tacaggatcc cgcggcaggg gaagatgcgc tgcgacgcgg tcttctacgc ctcgcgacgg       120
     atactggagg atctcgccgc cgaggactac gcctcgctgc ggcagctcat gggcgtggcc       180
     accctgcccg ggatagtcga gccggcgctc agcatgccgg acatccactg ggggtacggc       240
     ttccccatcg ggggggtggc cgccttcgac ccggaggagg gaggggtggt gagccccggg       300
     ggcgtcggct tcgacatcaa ctgcggggtc cggctcctgg tctcggacat aagccgggag       360
     gagctcgcgg accgcaaggc gcgcctcgcc gacgagctct tccggagcgt cccctccggg       420
     gtgggccggg gccgcaagga cttcaggatc gggcgccccg acctcaggcg gctgctcgtc       480
     gaggggccct cctggctggt ggagcggggc tacggggagc ccggggacct cgacggcatc       540
     gagtcccgcg ggcgactcgc cggggccgac cccgacgccg tctccgagag ggcctaccag       600
     cgggggcagc cgcagctcgg gaccctgggc tccggcaacc acttcctcga ggtccagtac       660
     gtggacgagg tctacgacga ggaggccgcc cgggcctacg ggctgcatcc ggggcaggtc       720
     accgtcctca tccactccgg ctcccggggg ctcgggcacc aggtgtgcac ggagtacgtg       780
     gagcgctttc tgcaggtcgc cccgaagtac ggcatcgagc tggtggaccg gcagctcgcc       840
     gccgccccca tagacagccc ggaggggagg gcctacctcg gggccatgtc cgcggcggcc       900
     aacttcgcct tcgccaaccg ccagctcata gcccacttca cccgggaggc cttcgcccgg       960
     gcgggctttg ggggccgtcc cctgcgggtg ctctacgacc tggcgcacaa caacgccaag      1020
     ctcgaggagc acggcgcgag gagggtgctc gtccaccgca agggggcgac gcgggccttc      1080
     ggccccggca accccgagct cccggagcgc taccgggggg tcggccagcc cgtgctggtg      1140
     ccgggcgaca tgggccgcta ctccttcgtg ctcgccggga ccgagggctc catgcgcgag      1200
     accttcggct ccagcgccca cggcgccggg cggaagatga gccgccgccg ggccaagaag      1260
     gccgcccggg gacgcgacct catccgggag atggagcagg tgggcatcct ggtgcgggcc      1320
     gcgggccggg ccacggtgga cgaggagatg tccgaggcct acaaggacgc cgccgaggtc      1380
     gtggaggtga ccgacggggc gggcatcggg aagaaggtgg cccgtctgag gcctcagata      1440
     gtggtgaagg gctag                                                       1455
//

If you have problems or comments...

PBIL Back to PBIL home page