(data stored in ACNUC7421 zone)

EMBL: CP000386.PE476

CP000386.PE476       Location/Qualifiers
FT   CDS_pept        518708..519691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0483"
FT                   /product="poly-gamma-glutamate synthesis protein (capsule
FT                   biosynthesis protein)"
FT                   /note="KEGG: dps:DP2296 poly-gamma-glutamate synthesis
FT                   protein (capsule biosynthesis protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03457"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYS1"
FT                   /protein_id="ABG03457.1"
FT                   /translation="MVVLNLAGDVMLGRGVNEALAEMPPEEVWGDVLPLLLEGGVRIVN
FT                   LECAITDHRRPWTRTPKVFHFRADPRAVRVLTAARIDAVSLANNHTLDFEERGLLDTIA
FT                   HLRSAGIACAGAGRDLAEASRPAVVEGGGERVALVAFTDNEPPFAAGPDRPGTNYLPVS
FT                   LEGEVLERVEEAVARARAEGAGTVVFSNHWGPNMVERPPECFRRFARAVIDRGADVYYG
FT                   HSAHVFQGVEVYRGRPILYDTGDFVDDYAVDPRLRNDRSFLFRVEVGEEGLRGLELFPV
FT                   RLPYARVRRAAGEEAEAIMERMERLSAEMGTRFERAGDRLLLRGPG"
     ttggtcgtcc tgaacctcgc cggggacgtc atgctcgggc ggggggtgaa cgaggcgctc        60
     gcggagatgc cccccgagga ggtgtggggc gacgtgctgc cgctcttgct ggagggcggg       120
     gtgcgcatcg tcaacctgga gtgcgcgatc acggatcaca gaaggccctg gacgcgcacc       180
     cccaaggtct tccacttccg ggccgacccg cgggccgtgc gggtgctgac cgcggcccgg       240
     atagacgccg tctccctcgc caacaaccac accctggact tcgaggagcg ggggctgctg       300
     gacaccatcg cccacctgcg gtccgccggg atagcctgcg cgggggcggg gcgggatctc       360
     gcggaggcct cgcgcccggc ggtggtggag ggcggcgggg agcgggtggc cctcgtggcc       420
     ttcaccgaca acgagccccc cttcgccgcc ggcccggacc ggcccggaac caactacctg       480
     ccggtctcgc tggaggggga ggtgctcgag cgggtggagg aggccgtagc ccgggcgcgc       540
     gccgaggggg ccgggaccgt cgtcttctcc aaccactggg ggccgaacat ggtcgagcgc       600
     ccgcccgagt gcttccggcg cttcgcccgg gccgtcatcg accgcggggc cgacgtctac       660
     tacggccaca gcgcccacgt cttccagggc gtcgaggtct accggggcag gcccatcctc       720
     tacgacaccg gcgacttcgt cgacgactac gccgtggacc cccggctgcg caacgaccgg       780
     tctttcctct tccgggtgga ggtgggcgag gaggggctgc gggggctcga gctcttcccg       840
     gtccggctcc cctacgcccg ggtgcggcgg gcggccgggg aggaggccga ggccatcatg       900
     gagcgtatgg agcggctctc ggccgagatg ggcacccgct tcgagcgcgc cggggaccgt       960
     ctgctcctcc gggggcccgg ctag                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page