(data stored in ACNUC7421 zone)

EMBL: CP000386.PE484

CP000386.PE484       Location/Qualifiers
FT   CDS_pept        526100..527011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0491"
FT                   /product="PfkB"
FT                   /note="PFAM: PfkB; KEGG: tfu:Tfu_2129 putative sugar
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03465"
FT                   /db_xref="GOA:Q1AYR3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR3"
FT                   /protein_id="ABG03465.1"
FT                   /translation="MSAPRVIVVGDVLYDMVARVEGGLPVGADSFVRIQDSPGGSGANV
FT                   AAWLASLGVEAHLVGRVGEDPLGDHLEAGLREAGVRTHLPRDPSLPTGRVFVLVDGSGE
FT                   RTMITDRGAGEALGPRDIPARLFAPGAHLHLTGYLFSGGGRREAALEALRLARSAAMSF
FT                   SVDPSSVTLLRAVGVERFAGWTSGADLLFPNLSEAALLSGRAEPEEAARRLLERYRAVV
FT                   LKLGPEGALYADREGRRARLPAPRVRRADATGAGDALCAAFLASWVRGEPPARALREGV
FT                   RLAARVVGRTGARGFRRTRGPC"
     gtgagcgccc cccgcgtcat cgtggtgggg gacgtgctct acgacatggt ggcgcgggtg        60
     gagggcgggc tccccgtggg cgccgacagc ttcgtccgga tccaggactc ccccggcggc       120
     tcgggggcga acgtggccgc ctggctggcc tccctgggcg tggaggcgca cctcgtcggg       180
     agggtggggg aggacccctt gggcgatcac ctggaggccg ggctgcggga ggcgggggtg       240
     aggacccacc tcccccggga cccctccctc cccaccggca gggtcttcgt gctggtcgac       300
     ggctccgggg agcgcaccat gatcacggac cgcggcgcgg gcgaggcgct ggggccgcgg       360
     gacatcccgg cccgcctgtt cgcccccggc gcccacctgc acctcaccgg ctacctcttc       420
     tccggcggcg gccgccggga ggccgccctc gaggcgctgc gcctcgcccg cagcgccgcc       480
     atgagcttct cggtcgaccc ctcctccgtg acgctgctgc gggcggttgg ggtggagcgc       540
     tttgcgggct ggacctccgg cgcggacctc ctcttcccca acctctccga ggccgccctg       600
     ctctccgggc gcgcggagcc ggaggaggcg gctcgccgcc tcctggagcg ctaccgggcc       660
     gtggtgctca agctcggccc cgagggggcg ctctacgccg accgggaggg caggcgcgcc       720
     cgcctgcccg cgccccgcgt ccggcgggcc gacgccaccg gggccgggga cgccctgtgc       780
     gccgccttcc tcgcctcttg ggtgcgcggc gagccgcccg cgcgggccct gcgggagggc       840
     gtgcggctcg ccgcccgggt cgtcgggcgc accggggccc gcggctttcg ccggacccgc       900
     gggccgtgct aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page