(data stored in ACNUC7421 zone)

EMBL: CP000386.PE487

CP000386.PE487       Location/Qualifiers
FT   CDS_pept        complement(530406..531362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0494"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: syn:slr0545
FT                   auxin-induced protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03468"
FT                   /db_xref="GOA:Q1AYR0"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYR0"
FT                   /protein_id="ABG03468.1"
FT                   /translation="MRTNGYERAPLASELGIEPLGVGAWAWGTRRLWGYGSGYGRAEVE
FT                   AALRESLAAGVRLVDTAEIYGNGESERIIGSILQEGGLPARPVLATKFAPYPYRLSPRS
FT                   LLRALDGSLRRLGVESVDLYQIHWYSPVPAPGGLLDALAEAVKEGRVRRVGVSNYGAEA
FT                   MRRAHERLASRGVPLASNQVEYSLLHRAPETDGTLEACRELNVTLIAYSPLAQGLLTGK
FT                   YAPGSRPAGLVRRFGRDFGERNLRRVQPVVGILREIAEPRGKTPAQVALNWLLAQSTLP
FT                   IPGAKDAGQARQNAGALGWTLTPEEKERLDLATLGWR"
     ttgagaacga acggctacga gagggcgccg ctggcgtcgg agctggggat agagcccctg        60
     ggggtcgggg cctgggcctg gggcaccagg aggctctggg gctacgggtc cggctacggc       120
     cgggcggagg tggaggcggc gctgcgggag agcctcgccg ccggcgtccg gctggtggac       180
     acagccgaga tctacggcaa cggggagtcc gagcggatca tcgggagcat cctgcaggag       240
     ggcggcctcc cggcccgtcc ggtgctggcg acgaagttcg ccccctaccc ctaccggctg       300
     agcccccgct cactgctgcg cgccctggac ggcagcttgc ggcggctggg ggtggagagc       360
     gtggacctct accagatcca ctggtactcc cccgtcccgg cccccggcgg gctgctggac       420
     gccctggccg aggcggtgaa ggagggcagg gtgcgccggg tgggggtgag caactacgga       480
     gcggaggcga tgcgccgcgc ccacgagcgg ctggcctccc gcggggtgcc cctggcctcc       540
     aaccaggtgg agtacagcct cctgcaccgg gccccggaga cggacgggac gctggaggcc       600
     tgccgggagc tgaacgtaac cctcatagcc tacagccccc tggcacaggg gctcctcacc       660
     ggcaagtacg cccccggctc ccgccccgcg ggcctcgtcc ggcggttcgg ccgggacttc       720
     ggcgagcgca acctgcgccg ggtgcagccg gtggtcggga tcctgcgcga gatcgcagag       780
     ccccgcggca aaacccccgc ccaggtggcc ctcaactggc tcctcgccca gagtaccctc       840
     cccatccccg gcgccaagga cgcgggccag gcccgccaga acgccggggc cctcgggtgg       900
     accctcaccc cagaggagaa ggagcggctc gacctcgcca ccctcgggtg gcgatga          957
//

If you have problems or comments...

PBIL Back to PBIL home page