(data stored in ACNUC7421 zone)

EMBL: CP000386.PE492

CP000386.PE492       Location/Qualifiers
FT   CDS_pept        534936..535295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0499"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03473"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ5"
FT                   /protein_id="ABG03473.1"
FT                   /translation="MELKNKEELRGEILQSWLRNAWVYPVEGPDRKVYLRLTPGGRLKM
FT                   RKKIGEMERSLGVSGPELARQDEAGTLPLDRDRLELAMMVRAYTSERRFIESSGATLGT
FT                   PAVTLEEEREEGASS"
     atggagctca agaacaaaga ggagcttaga ggcgagatcc tgcagtcctg gctccggaac        60
     gcctgggtct acccggtgga ggggccggac agaaaggtct acctgcgcct cacgccgggg       120
     gggaggctca agatgcgcaa gaagatcggg gagatggagc gctccctcgg cgtgagcggc       180
     ccggagctgg cccggcagga cgaggccggg accctgccgc tcgaccggga ccggctggag       240
     ctggccatga tggtccgggc ctacacctcc gagcggcgct ttatagagag ctcgggggcc       300
     accctgggca cccccgccgt caccctggag gaggaaagag aggagggggc ctcctcctag       360
//

If you have problems or comments...

PBIL Back to PBIL home page