(data stored in ACNUC7421 zone)

EMBL: CP000386.PE493

CP000386.PE493       Location/Qualifiers
FT   CDS_pept        complement(535292..536020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0500"
FT                   /product="Amino acid ABC transporter, permease protein,
FT                   3-TM region, His/Glu/Gln/Arg/opine"
FT                   /note="TIGRFAM: Amino acid ABC transporter, permease
FT                   protein, 3-TM region, His/Glu/Gln/Arg/opine; PFAM:
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; KEGG: sao:SAOUHSC_01991 ABC transporter,
FT                   permease protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03474"
FT                   /db_xref="GOA:Q1AYQ4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ4"
FT                   /protein_id="ABG03474.1"
FT                   /translation="MPDWWPPVEINPQDLSPERLVGYYLDFGVVLENPAPLLKGLAVTL
FT                   SLAALAEVVGIVLGLFLALLKISRSRLLSLPAQVYIDVFRGTPLLVQITIIYFTTAAVG
FT                   IRFTSLFFAGLTALSLNSAAYVAEIFRAGIQSIDKGQMEAGRASGLSYAQTMRYIIVPQ
FT                   AFRRVIPPLTNEFVTLIKDTSLVSVIGLAELLRAARVLQSATFNGTPLIAAALIYLAVC
FT                   LPLIYLTNILERRLNRRTAA"
     atgcccgact ggtggccgcc ggtagagatc aacccgcagg acctctcgcc ggagaggctg        60
     gtcggctact acctggactt cggggtggtc ctggagaacc ccgcccccct cctcaagggg       120
     ctcgccgtga ccctctcgct ggcggccctg gcggaggtcg tcgggatagt gctggggctc       180
     tttctggcgc tgctcaagat ctcgcgctcc aggctcctga gcctcccggc gcaggtctac       240
     atagacgtct tccggggaac cccgctgctg gtccagatca cgatcatcta cttcaccacg       300
     gcggcggtgg gcatccggtt cacgagcctc ttcttcgccg ggctcaccgc cctctccctc       360
     aacagcgccg cctacgtggc ggagatcttc cgggccggca tacagtccat agacaagggc       420
     cagatggagg ccggaagggc ctcggggctc tcctacgccc agacgatgcg ctacatcatc       480
     gtgccgcagg ccttccggag ggtcatcccc ccgctgacca acgagttcgt caccctcata       540
     aaggacacct cgctggtgag cgtgatcggg ctggccgagc tgctgcgggc cgcccgggtg       600
     ctccagtcgg ccacgttcaa cgggacgccg ctgatcgcgg cggcgctcat ctacctggcg       660
     gtctgcctgc ccctgatcta cctgaccaac atcctggagc ggcgcctgaa ccgcaggacg       720
     gcggcctag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page