(data stored in ACNUC7421 zone)

EMBL: CP000386.PE494

CP000386.PE494       Location/Qualifiers
FT   CDS_pept        complement(536044..536889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0501"
FT                   /product="extracellular solute-binding protein, family 3"
FT                   /note="PFAM: extracellular solute-binding protein, family
FT                   3; SMART: Ionotropic glutamate receptor; KEGG: chy:CHY_0504
FT                   glutamine ABC transporter, glutamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03475"
FT                   /db_xref="GOA:Q1AYQ3"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ3"
FT                   /protein_id="ABG03475.1"
FT                   /translation="MPERKVVARSFATLALALAAALLLAAACGGGEGGGGGEQTAAGGG
FT                   EGTAGMEAGRTITVASDIAYRPFEFYRNGEPVGFDIDLMREIGRRAGFTPEFQNVTFDG
FT                   IIPGLGSNLYDAAISAITITEERRQQVDFSEPYFNADQSLLVRSDSDIRSVDDLGQATV
FT                   GVQIGTTGANKANQFQQQGRIAEVRTFDTIEDAFTALENGQVDAVINDLPVSQDKANTS
FT                   DGRLEVVQVIPTGEQYGIAFPKGSNLVGPVNRALREIKRDGTYAEIYEKWIGRKPEEIP
FT                   "
     atgccggaga gaaaggtagt agcgcgaagc ttcgcgacgc tggcgctggc gctcgccgcc        60
     gccctgctcc tcgccgcggc ctgcggcggc ggggaggggg gaggcggcgg cgagcagacc       120
     gccgcggggg gcggcgaggg gacggccggg atggaggccg gccggaccat caccgtcgcc       180
     tccgacatag cctacaggcc cttcgagttc tacagaaacg gcgagccggt cggcttcgac       240
     atagacctga tgcgcgagat cggcaggcgg gcggggttca cccccgagtt ccagaacgtc       300
     accttcgatg gcatcatccc cggcctcggc tccaacctct acgacgcggc gatctccgcg       360
     atcaccataa ccgaggagcg ccgccagcag gtggacttct ccgagcccta cttcaacgcc       420
     gaccagtcgc tgctggtgcg cagcgactcc gatatccgct cggtggacga cctcgggcag       480
     gccacggtgg gcgtccagat aggcaccacc ggcgccaaca aggccaacca gttccagcag       540
     cagggcagga tagccgaggt gcgcaccttc gacaccatag aggacgcctt caccgcgctg       600
     gagaacggcc aggtggacgc ggtaataaac gacctgcccg tctcgcagga caaggccaac       660
     accagcgacg gcaggctcga ggtggtgcag gtcatcccca ccggggagca gtacgggatc       720
     gccttcccca aggggagcaa cctggtcggc ccggtgaacc gggcgctccg ggagataaag       780
     cgcgacggca cctacgccga gatctacgag aagtggatcg ggcgcaagcc cgaggagata       840
     ccctga                                                                  846
//

If you have problems or comments...

PBIL Back to PBIL home page