(data stored in ACNUC7421 zone)

EMBL: CP000386.PE497

CP000386.PE497       Location/Qualifiers
FT   CDS_pept        538472..539575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0504"
FT                   /product="glucose sorbosone dehydrogenase"
FT                   /note="PFAM: glucose sorbosone dehydrogenase; KEGG:
FT                   cbu:CBU_0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03478"
FT                   /db_xref="GOA:Q1AYQ0"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYQ0"
FT                   /protein_id="ABG03478.1"
FT                   /translation="MGPPSLLAPLALLLSFLLAVSCAGEAPPGGREGVGPLRVETVLSG
FT                   LDTPWEVVFAPDGRVFVTERPGRVLVVEDGELREEPYARLPVEEVGEGGQLGLALHPNF
FT                   RRNGVLYAYYTTREDGRLRNRLVRLVEEDGSARQEEVLLEGPAASIHDGGRVRVGPDGK
FT                   LYATLGDTADAGLAQDPRALAGKIIRLNLDGSVPRDNHFPGSPVYSYGHRNPQGLAWDE
FT                   AGNLYAPEHGQSAHDELNLVRPGRNYGWPVIEGGERREGMVAPILHSGEKTWAPSGAEY
FT                   VREGPWRGSILFTGLRGESLHRVEVDPEDPGRVVRHREYLEGEYGRLRTVVQGPDGALY
FT                   LLTSNRDGRGDPAPSDDRLLRVEVGGR"
     gtggggcctc ctagcctcct cgccccgctc gccctcctcc tgtcttttct cctcgccgtc        60
     tcctgcgccg gggaggcccc tccggggggc cgggaggggg tgggccccct ccgggtggag       120
     acggtcctct cggggctcga caccccctgg gaggtggtct tcgcgcccga cggccgggtc       180
     ttcgtgaccg agcggccggg gagggtgctc gtggtcgagg acggcgagct ccgggaagag       240
     ccctacgccc ggctcccggt ggaggaggtg ggcgagggcg ggcagctcgg gctggccctc       300
     cacccaaact tccggcgcaa cggcgtcctg tacgcctact acaccacccg ggaggacggc       360
     cggctgcgca acaggctggt gcggctcgtg gaggaggacg gctccgcccg gcaggaggag       420
     gtgctcctcg agggtccggc ggcctccatc cacgacggcg ggcgggtccg ggtcgggccc       480
     gacggcaagc tctacgccac cctcggcgac accgccgacg ccgggctcgc ccaggacccg       540
     cgggcgctcg ccgggaagat catacgcctc aacctggacg gctccgtccc ccgagacaac       600
     cacttccccg gctcgccggt ctactcctac gggcaccgca acccgcaggg gctcgcctgg       660
     gacgaggcgg gcaacctcta cgcccccgag cacggccaga gcgcccacga cgagctgaac       720
     ctcgtaaggc ccggcagaaa ctacggctgg cccgtcatag agggcgggga gcgccgggag       780
     gggatggtcg cgcccatcct gcacagcggg gaaaagacct gggccccctc cggggccgag       840
     tacgtgaggg aggggccgtg gagggggagc atcctgttca ccggcctgcg cggggagtcg       900
     ctgcaccgcg tcgaggtgga ccccgaggac cccgggaggg tcgtgcgcca ccgggagtac       960
     ctcgaggggg agtacgggcg gctcaggacc gtggtgcagg gtcccgacgg cgcgctctac      1020
     ctgctcacca gcaaccgcga cgggcgcggg gaccccgccc cctccgacga ccggctgctg      1080
     cgggtcgagg ttggcggccg gtaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page