(data stored in ACNUC7421 zone)

EMBL: CP000386.PE499

CP000386.PE499       Location/Qualifiers
FT   CDS_pept        540752..541486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0506"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   rpb:RPB_1485 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03480"
FT                   /db_xref="GOA:Q1AYP8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP8"
FT                   /protein_id="ABG03480.1"
FT                   /translation="MGVLVALGAAFAAGAVSGLTGFGLALVGVPLLLFVYDPATVVVLI
FT                   MAFSLLINAAVVQDSWRKVDRRMAAALSPPALAGVAGGTEVLRVASPEQLRLAVGVLVV
FT                   LSALLMLRDVRLPGTGSRLAPAVAGLVSGALSTSVGLAAPPVVLLLAARGLPKAAFRAT
FT                   SALFFLVMSVFGAAALAARGLIPEGSLSLAAALLPAALAGKLAGTALVGRIPEGAFRRI
FT                   TLLLTLATGALGAATALLALLR"
     gtgggcgtcc tcgttgccct gggggcggcg ttcgccgccg gggcggtctc ggggctcacg        60
     ggcttcgggc tggcgctggt gggggtgccg ctcctattgt tcgtctacga cccggcgacg       120
     gtggtcgtgc tgatcatggc cttctccctg ctcataaacg ccgccgtcgt gcaggactcc       180
     tggcggaagg tagaccggcg gatggcggcc gccctctcgc ccccggcgct ggccggggtg       240
     gccgggggca ccgaggtgct gcgggtggcg agccccgagc agctgcggct ggccgtgggg       300
     gtcctggtgg tcctctccgc cctactgatg ctgcgggacg tgcggctgcc ggggacgggg       360
     tcccggctgg ccccggcggt ggcggggctg gtgagcgggg cgctctccac ctccgtcggg       420
     ctggccgccc cgcccgtggt gctgctgctc gccgcccgcg ggctgccgaa ggcggccttc       480
     cgggccacca gcgccctctt cttcctggtg atgagcgtct tcggcgcggc ggccctcgcc       540
     gcccgcggcc tcatcccgga ggggagcctc tcgctcgcgg ccgccctcct gccggcggcg       600
     ctggcgggca agctcgccgg gaccgcgctc gtcgggcgca tcccggaggg ggccttccgc       660
     aggatcacgc tgctcctcac cctggccacc ggcgccctcg gcgcggccac cgccctcctc       720
     gcgctcctgc gctga                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page