(data stored in ACNUC7421 zone)

EMBL: CP000386.PE504

CP000386.PE504       Location/Qualifiers
FT   CDS_pept        544718..546937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0511"
FT                   /product="DEAD/DEAH box helicase-like protein"
FT                   /note="PFAM: helicase-like DEAD/DEAH box helicase-like;
FT                   KEGG: deh:cbdb_A928 ATP-dependent RNA helicase, DEAD"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03485"
FT                   /db_xref="GOA:Q1AYP3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP3"
FT                   /protein_id="ABG03485.1"
FT                   /translation="MVASLGPRPASLVEPPGDLHPALREALRRGGMARLYSHQREAYER
FT                   LRCGENVVVATATASGKSLCYKLFAFQGVLEEPRSRALFLYPTKALAQDQLGKIRAFGL
FT                   RGVRPATYDGDTPQPLRADIRRRANVVLTNPDMLSVGILPNHDAWGPFLRGLRVVAVDE
FT                   AHVLRGVFGSHVAAVLRRLRRLARLHGGDPRFVLTSATIANPQELAETLTGLPFSPVER
FT                   DGAPSGERRVVFRNPPLLDRERGERRSLLTEGALVFAALVSQGVRTIAFARTRRAAELI
FT                   YRYAADRLGPEGARRISPYRAGYTPGERREIEGRLFRGELLGVVSTNALELGVDVGSLD
FT                   AAICCGYPGSVASVWQQWGRAGRGEGASLAVYIPGRDALDQFLYENPQRILGRRVEAAR
FT                   LTLDNPYILAPHLLAAAREAPLEPEDEEFFGPQYGRVAGELEEAGALLRSGGRLVYAGV
FT                   GSPARGISLRSASSETVVIADGEGELVGTAEAARAPSELHPGAVYLHRGAAYEVERLDL
FT                   AARRALVRRVPDRFYTRPRVETDVEILEELERRPLSGGALLHRGRVRTTDAVTHYKKVR
FT                   VADDREVGVFPLDLPEVSLETQALWVTLPPPPPEGRPSFEGFGGALHAAEHGLIGLLPL
FT                   FAMCDRADIGGLSTPVHRQTGRPTIFVYDGYPGGVGIAHRGFDAFPSLARDALGAIVRC
FT                   PCERGCPGCVQSPKCGNWNEPLSKEGAVWLLRFVLGQVDRHPALS"
     gtggtggcga gcctcgggcc ccgccccgcg agcctcgtcg agccgcccgg cgacctccac        60
     cccgccctgc gcgaggcgct ccggcggggc ggcatggccc gcctgtactc ccaccagcgg       120
     gaggcctacg agcggctgcg ctgcggggag aacgtggtgg tcgccaccgc caccgcgagc       180
     gggaagtccc tctgctacaa gctcttcgcc ttccagggcg tcctggagga gccccgcagc       240
     cgggcgctgt tcctctaccc cacgaaggcg ctcgcccagg accagctcgg caagatccgg       300
     gccttcgggc tgcgcggcgt ccgaccggcc acctacgacg gggacacccc ccagcccctg       360
     cgggcggaca tccggcggcg ggccaacgtc gtgctcacca acccggacat gctgagcgtg       420
     ggcatcctcc ccaaccacga cgcctggggg ccctttctgc gggggctgcg ggtggtggcg       480
     gtggacgagg cgcacgtgct gcgcggggtc ttcggctcgc acgtggcggc ggtcctgcgg       540
     cggctgcggc ggttggcgcg gctgcacggc ggcgaccccc gcttcgtcct caccagcgcc       600
     accatcgcca acccccagga gctcgccgag accctcaccg ggctcccctt ctccccggtg       660
     gagcgggacg gggcgccctc cggggagcgc cgggtcgtct tccgcaaccc cccgctgctg       720
     gaccgggagc gcggcgagcg gcggagcctg ctcaccgagg gggcgctggt cttcgccgcg       780
     ctcgtctcgc agggggtaag gaccatagcc ttcgcccgca cccgccgggc ggccgagctc       840
     atctaccgct acgccgccga ccggctcggc cccgaggggg cgcgcaggat ctcgccctac       900
     cgcgccgggt acaccccggg ggagcgccgg gagatagagg ggcgcctgtt ccgcggcgag       960
     ctgctcgggg tggtctccac caacgccctg gagctggggg tggacgtggg gtcgctggac      1020
     gccgcgatct gctgcgggta cccgggcagc gtggcctccg tctggcagca gtgggggcgg      1080
     gccgggcgcg gggagggggc ctccctcgcc gtctacatcc ccgggcggga cgcgctggac      1140
     cagttcctct acgagaaccc gcagcggatc ctggggcggc gggtggaggc cgcccgcctc      1200
     acgctggata acccctacat cctcgccccg cacctgctcg cggcggcccg cgaggcccct      1260
     ctggagcccg aagacgagga gttcttcggg ccgcagtacg ggcgggtggc cggggagctg      1320
     gaggaggccg gggcgctgct ccggagcggc gggcggctgg tgtacgccgg ggtgggcagc      1380
     ccggcgcgcg ggatctcgct gcgctccgcc tcctcggaga cggtcgtgat cgccgacggg      1440
     gagggggagc tggtggggac cgccgaggcc gcccgcgccc cctccgagct ccacccgggg      1500
     gcggtgtatt tgcaccgcgg ggcggcctac gaggtggagc gtctggacct cgcggcccgc      1560
     cgggcgctcg tccgccgggt ccccgaccgc ttctacaccc ggccgcgggt ggagacggac      1620
     gtggagatcc tggaggagct ggagaggcgg ccgctctcgg gcggggctct cctccaccgg      1680
     ggccgggtga ggaccaccga cgccgtgacc cattacaaga aggtccgggt cgccgacgac      1740
     cgggaggtgg gggtgttccc gctggacctg ccggaggtct cgctcgagac gcaggccctc      1800
     tgggtcacgc tgccccctcc cccgccggag ggccgcccga gcttcgaggg cttcggcggc      1860
     gccctgcacg ccgccgagca cggcctaatc gggcttctgc ccctctttgc catgtgcgac      1920
     cgggcggaca tcggcgggct ctccaccccg gtccaccgcc agacgggccg gcccacgatc      1980
     ttcgtctacg acggctaccc gggcggggtc ggtatagcgc accgcggctt cgacgccttc      2040
     ccctccctgg cccgcgacgc cctgggcgcc atcgtgcgct gcccgtgcga gcgggggtgc      2100
     ccgggctgcg tccagtcccc gaagtgcggc aactggaacg agccgctgag caaggagggg      2160
     gcggtatggc tgctgcgctt cgtgctcggg caggtggacc ggcacccggc cctctcgtga      2220
//

If you have problems or comments...

PBIL Back to PBIL home page