(data stored in ACNUC7421 zone)

EMBL: CP000386.PE505

CP000386.PE505       Location/Qualifiers
FT   CDS_pept        546934..547398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="TIGRFAM: conserved hypothetical protein; KEGG:
FT                   mka:MK1390 predicted Rossmann fold nucleotide-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03486"
FT                   /db_xref="InterPro:IPR005268"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYP2"
FT                   /protein_id="ABG03486.1"
FT                   /translation="MSGAPYISVVGSGRASGELYELAREVGRLVAGRGAVVVCGGLGGV
FT                   MEAAARGAREAGGVAIGVLPGEDRRGANRYLTYAVATGAGQARNLAVVCSGDAVIAVGG
FT                   EYGTLSEIGLARKVGRPVVVLRGWELGPHVAVAATPREAVERAFGMIGAL"
     gtgagcggcg ccccctacat ctcggtcgtg ggctcggggc gggcctccgg ggagctctac        60
     gagctcgcgc gcgaggtggg gcgcctggtg gccgggcgcg gcgcggtggt ggtgtgcggg       120
     gggctcggcg gggtgatgga ggccgccgcc cggggggcga gggaggccgg gggcgtggcc       180
     ataggggtgc tccccggcga ggaccgcagg ggggccaacc gctacctcac ctacgcggtg       240
     gccaccgggg ccgggcaggc gcggaacctg gcggtcgtct gctcggggga cgcggtgatc       300
     gccgtgggcg gggagtacgg gacgctctcc gagatagggc tcgcccgcaa ggtggggcgt       360
     ccggtggtgg tgctgcgggg ctgggagctc ggcccccacg tcgcggtcgc cgccaccccg       420
     cgcgaggcgg tggagagggc cttcggtatg atcggggcgt tgtag                       465
//

If you have problems or comments...

PBIL Back to PBIL home page