(data stored in ACNUC7421 zone)

EMBL: CP000386.PE509

CP000386.PE509       Location/Qualifiers
FT   CDS_pept        549704..550480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0516"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mta:Moth_1083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03490"
FT                   /db_xref="GOA:Q1AYN8"
FT                   /db_xref="InterPro:IPR005235"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYN8"
FT                   /protein_id="ABG03490.1"
FT                   /translation="MLRLLFVGDVVGEGAVDAVVGLLPRLREELGLDAAVVNGENAAGG
FT                   AGITPQLAERLLSAADFITLGDHAFDREEAAAYLDREGRIIRPANLPEGLPGRGWGAFE
FT                   AGGARVGVACVQGRLFMREACSPFEAADRALEGLRGADLVLFDLHAEATSEKQALGWHL
FT                   DGRAAAALGTHTHVPTADLRLLPGGTAYVSDVGMAGSPDGIIGMDREGFMEVFLRRRRA
FT                   PVTPARGPVRVDAVLVEADPKSGRAVGASRVFREAA"
     gtgctccgcc tgctgttcgt cggggatgtg gtgggggagg gggccgtcga cgcggtcgtc        60
     gggctcctgc cgcggctgcg cgaggagctg gggctggacg ccgcggtcgt caacggggag       120
     aacgccgccg gcggggccgg gataaccccg cagctggcgg agaggctgct ctccgcggcg       180
     gacttcatca cgctggggga ccacgccttc gaccgggagg aggcggccgc ctacctggac       240
     cgggaggggc gcatcatccg gcccgccaac ctgcccgagg ggctgccggg gcgcgggtgg       300
     ggcgccttcg aggccggcgg ggcgcgcgtc ggggtggcct gcgtgcaggg gcggctgttc       360
     atgcgggagg cgtgctcccc cttcgaggcg gccgaccggg cgctcgaggg gctgcgggga       420
     gcggacctcg tcctcttcga cctgcacgcc gaggcgacca gcgagaagca ggcgctcggc       480
     tggcacctcg acgggcgggc ggcggccgcg ctcggcaccc acacccacgt ccccaccgcc       540
     gatctgcgcc tgctcccggg cgggacggcc tacgtctcgg acgtggggat ggcgggctcg       600
     cccgacggga tcatcgggat ggaccgggag gggttcatgg aggtcttctt gcggcggcgc       660
     cgggcccccg tgaccccggc gcgcgggccg gtgcgggtgg acgcggtgct ggtggaggcc       720
     gacccgaaga gcggccgggc cgtcggggcc agccgcgtct tccgggaggc cgcctag          777
//

If you have problems or comments...

PBIL Back to PBIL home page