(data stored in ACNUC7421 zone)

EMBL: CP000386.PE513

CP000386.PE513       Location/Qualifiers
FT   CDS_pept        complement(552566..553228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0520"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sma:SAV1204 putative IS630 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03494"
FT                   /db_xref="GOA:Q1AYN4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYN4"
FT                   /protein_id="ABG03494.1"
FT                   /translation="MSGGPGAALRARVYLRDSARAGDRPAYEAVAECIFRIGFGLRVTV
FT                   RSMKSPIFVRSLSENEREDLEAGLRSKDAFVMRRSQILLASSRGEKAPKIAENLGCGTQ
FT                   TVRDAIHDFNERGPDALVARSSRPKRTRDAFDEESAERLRGMLHRSPREFGRESSLWTL
FT                   EMAAEVAFEEGLTQRRVSGETIRATLARLLGVRWQRAKRWITSPDPLYERKKEGATC"
     gtgagcgggg ggcccggggc cgcgctgcgg gcccgcgtct acctccgcga ctccgcccgc        60
     gccggggacc gcccggccta cgaggccgtc gccgagtgca tcttcaggat aggtttcggg       120
     ttgcgagtta cagtaaggtc catgaaatct ccaatctttg tacgttcgtt gtcggaaaac       180
     gagcgcgaag acctcgaagc cgggctgcgc tccaaagacg ccttcgtaat gcgccgatca       240
     cagatacttc ttgccagctc caggggtgag aaagctccga agatcgccga gaatctcggc       300
     tgcgggacgc agacggtgcg cgacgccatc cacgacttca acgagagggg tcccgacgct       360
     ctcgttgcca gatcctcgcg ccccaagaga acccgcgacg ccttcgacga ggagagtgcc       420
     gagcggcttc gggggatgct ccaccgctct ccgagggagt tcggtcgcga gtcgagcctg       480
     tggactttgg agatggccgc ggaggtcgct ttcgaggagg ggctcacaca aaggcgggtc       540
     tcgggggaga cgatccgggc cactttggcg cgccttctcg gagtgagatg gcagcgagcc       600
     aaacgctgga tcacatctcc cgaccccttg tacgaaagaa aaaaagaagg cgcgacctgc       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page