(data stored in ACNUC7421 zone)

EMBL: CP000386.PE517

CP000386.PE517       Location/Qualifiers
FT   CDS_pept        554886..555290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0524"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related,
FT                   FMN-binding; KEGG: nfa:nfa7500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03498"
FT                   /db_xref="GOA:Q1AYN0"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="InterPro:IPR019966"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYN0"
FT                   /protein_id="ABG03498.1"
FT                   /translation="MAVVEPWVERRLREEKILWLTTVRADGQPQPVPVWFLWGTEGFLI
FT                   YSRPNAQKLRNIRSNPRVGLNLNCDERGGSVVRAEGTAEIVEDAAPASEIPEYVQKYRE
FT                   DMRRLGYEPAGFALDYAVAVRVTPRRWQSW"
     gtggcggtgg tggagccctg ggtcgagcgg cggctgaggg aggagaagat cctctggctc        60
     accacggtgc gggcggacgg ccagccgcag ccggtgccgg tgtggttttt gtgggggacg       120
     gagggttttt tgatctactc caggcccaac gcccagaagc tgcgcaacat ccgctcgaac       180
     ccgcgggtgg ggctgaacct gaactgcgac gagcggggag ggagcgtggt gcgggcggag       240
     gggacggcgg agatcgtgga ggacgccgcc ccggcctcgg agatcccgga gtacgtgcag       300
     aagtaccggg aggacatgcg ccggctgggc tacgagccgg cgggcttcgc gctggactac       360
     gcggtcgccg tccgggtgac cccgcgccgc tggcagagct ggtag                       405
//

If you have problems or comments...

PBIL Back to PBIL home page