(data stored in ACNUC7421 zone)

EMBL: CP000386.PE52

CP000386.PE52        Location/Qualifiers
FT   CDS_pept        53861..54931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0052"
FT                   /product="Glucose-6-P dehydrogenase subunit-like protein"
FT                   /note="KEGG: gvi:glr3179 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03033"
FT                   /db_xref="InterPro:IPR004555"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AZZ5"
FT                   /protein_id="ABG03033.1"
FT                   /translation="MIGELRRAGGGGRMSVEEVERELARLRMGEDGRLGLRASVLNLIA
FT                   VTGEETAPRVAEAVSRLAGEHPSRTVLLISDPAGADRMDVRLSAFCTPRGGGTQVCAEQ
FT                   ITIHAEGAPARHLESIAGPLLIPDLPVFLFYTGSFSASSPEFSRIARLADRLIVDSSSW
FT                   DGCGSAFGAVAEVLSRPDLPPAGDLQWATLTPWRTLIAEMFASPERAGELSGIEEVEIR
FT                   HAPDGECRALLLAGWLASSLGWRLEAASGSPPARELRFSGPPGGVRLRMEPAAPGARLA
FT                   RVTLRSPGCEFRVSRNLDRPEARATVSRGGRVVGESTAHVGRFDMSAMLAEELRCRGRD
FT                   AAYERALGAAVEVLGA"
     gtgatcgggg agctgcgccg cgccgggggc gggggacgga tgagcgtcga ggaggtcgag        60
     cgcgagctgg cccgcctgag gatgggagag gacgggcggc tcgggctgcg ggccagcgtc       120
     ctcaacctga tagcggtgac cggcgaggag acggcgccgc gcgtcgccga ggccgtctcc       180
     cggctggccg gggagcaccc ctcccggacg gtgctcctga tctcggaccc cgcgggggcg       240
     gaccggatgg acgtgcggct ctcggccttc tgcacccccc gcggcggcgg gacccaggtg       300
     tgcgccgagc agatcaccat ccacgccgag ggggcgcccg cgcggcacct ggagagcatc       360
     gccggtccgc tcctgatccc ggacctcccg gtttttttgt tctacacggg gagcttctcg       420
     gcctcctcgc cggagttctc caggatcgcc cggctggcgg accgcctgat cgtggactcc       480
     tcctcgtggg acggctgcgg cagcgcgttc ggggcggtcg ccgaggtgct ctcccggccc       540
     gacctgccgc ccgcgggcga cctgcagtgg gcgacgctca cgccctggcg caccctgatc       600
     gccgagatgt tcgcctcccc ggagcgcgcg ggggagctgt ccgggataga ggaggtggag       660
     atccgccacg ccccggacgg cgagtgccgg gcgctgctgc tcgccggctg gctggcctcc       720
     tccctcggct ggcggctgga ggctgcctcg ggctcccccc cggcgcgcga gctgcgcttc       780
     tcgggccccc ccggaggggt gaggctccgc atggagcccg ccgccccggg cgcccggctc       840
     gcccgggtga ccctgcgctc ccccggctgc gagtttcgcg tctcgcgcaa cctggaccgc       900
     ccggaggccc gggcgacggt ctcgcggggg ggccgggtgg tgggcgagag cacggcgcac       960
     gtcgggcggt tcgacatgag cgcgatgctg gccgaggagc tccgctgccg gggccgcgac      1020
     gcggcctacg agcgggcgct cggggccgcc gtggaggtgc tcggggcttg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page