(data stored in ACNUC7421 zone)

EMBL: CP000386.PE523

CP000386.PE523       Location/Qualifiers
FT   CDS_pept        559688..560794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0530"
FT                   /product="oxidoreductase-like protein"
FT                   /note="PFAM: oxidoreductase-like Oxidoreductase-like; KEGG:
FT                   rba:RB7494 probable NADH-dependent dyhydrogenase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03504"
FT                   /db_xref="GOA:Q1AYM4"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM4"
FT                   /protein_id="ABG03504.1"
FT                   /translation="MAGIDLDLKHLPELGSKTDYRIGAIGAGFIMRDVQLAAYDEAGFD
FT                   VVAIASRTPEHARSCAERWGIGRVYETWRELLDDPEVEILDIAYPPDRQLGIVREAVEH
FT                   ADHIKGILAQKPLATTLEDAAEIVRLCEEAGVVLGVNQNMRYDQSMRALKTLLDRGYLG
FT                   EPVVAQIVMHARPHWQDFLRGLDRLAMLNMSIHHLDIFRFLFGDPERILASVREDPSIG
FT                   FEHADGMAFYILEYAGGLRAVSIDNCFTWTDHGIEWRVEGTEGVARGTIGWPDYPEGSP
FT                   STVDFTTKRQPGYWFLPRWEERWFPQAFIGTMGQLMRALEEGSEPEISGRDNLRTMALV
FT                   EAAYRSVAEGRAVRLDEVGTKEATGGSA"
     gtggcgggca tagacctcga cctcaagcac ctgccggagc tggggagcaa gaccgactac        60
     cggatcgggg ccatcggcgc cgggttcatc atgcgcgacg tgcagctcgc cgcctacgac       120
     gaggccggct tcgacgtggt ggcgatcgcc tcgcgcacgc cggagcacgc ccgctcctgc       180
     gcggagcgct gggggatcgg ccgggtctac gagacctggc gggagctgct ggacgacccg       240
     gaggtcgaga tcctcgacat cgcctacccg ccggaccggc agctgggcat cgtgcgcgag       300
     gcggtggagc acgcggacca cataaagggg atactcgccc agaaaccgct ggccaccacc       360
     ctggaggacg ccgccgagat cgtccgcctc tgcgaggagg ccggcgtcgt cctcggggtg       420
     aaccagaaca tgcgctacga tcagtccatg cgggccctga agaccctgct cgaccggggc       480
     tacctgggcg agcccgtcgt cgcccagatc gtcatgcacg cccgcccgca ctggcaggac       540
     ttcctccggg ggctggaccg gctggcgatg ctcaacatga gcatccacca cctggacatc       600
     ttccgcttcc tcttcggcga cccggagcgc atcctggcga gcgtccggga ggacccgagc       660
     atagggttcg agcacgccga cgggatggcc ttctacatcc tggagtacgc gggcggcctg       720
     cgcgccgtct ccatcgacaa ctgcttcacc tggaccgacc acggcataga gtggcgggtc       780
     gagggcacgg agggcgtggc caggggcacc atcggctggc ccgactaccc ggagggtagc       840
     cccagcaccg tggacttcac caccaagcgg cagcccggct actggttcct gccccggtgg       900
     gaggagcgct ggttccccca ggcgtttata gggacgatgg gccagctcat gcgggccctc       960
     gaggagggct cggagccgga gatctccggc cgcgacaacc tgaggaccat ggccctggtg      1020
     gaggccgcct accggtcggt cgccgagggg agggcggtga ggctcgacga ggtcggcacg      1080
     aaggaggcta cgggtggcag cgcttga                                          1107
//

If you have problems or comments...

PBIL Back to PBIL home page