(data stored in ACNUC7421 zone)

EMBL: CP000386.PE524

CP000386.PE524       Location/Qualifiers
FT   CDS_pept        560781..561533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0531"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR Insect
FT                   alcohol dehydrogenase family; KEGG: sco:SCO0365 probable
FT                   oxidoreductase (secreted protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03505"
FT                   /db_xref="GOA:Q1AYM3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM3"
FT                   /protein_id="ABG03505.1"
FT                   /translation="MAALDGKVAVVTGGGGGLGEGICAGLAAAGAAVAAVDVDLEKARR
FT                   VERLVAGRGGRCVAVEADVSSRRSVERMAERVAGELGGIDILVNNAAIYPLRPWTEIDE
FT                   EEWDRVLAVNIKGYFLCARAAYPYMRERGGGRIINVASITFFIGWAGFLDYVSSKGAVV
FT                   GFTRTLAREVGPEGITVNAVSPGAFPTDAERVHPDQEALNRRILDAQCIKRRGKPEDVG
FT                   NLVTFLASEEASFITGQTIEIDGGWAMH"
     gtggcagcgc ttgacggaaa ggtcgcggtg gtaaccggcg ggggcggcgg gctcggcgag        60
     ggcatctgtg ccgggctcgc cgccgccggg gccgccgtgg ccgcggtgga cgtggacctg       120
     gagaaggcgc ggcgggtgga gcggctcgtc gccggcaggg gcgggcgctg cgtggccgtc       180
     gaggccgacg tctccagccg ccgctccgtg gagcgcatgg cggagcgggt cgccggcgag       240
     ctggggggca tagacatcct ggtcaacaac gccgccatct accctctgcg tccctggacc       300
     gagatagacg aggaggagtg ggaccgggtg ctcgcggtca acatcaaggg gtacttcctg       360
     tgcgcccggg ccgcctaccc gtacatgagg gagcgggggg gagggaggat catcaacgtc       420
     gcctccataa ccttcttcat cggctgggcg ggctttctgg actacgtctc ctccaagggg       480
     gcggttgtgg gcttcacccg cacgctggcc cgggaggtgg gtcccgaggg gatcacggtg       540
     aacgccgtct cccccggggc cttccccacc gacgccgagc gggttcaccc cgaccaggag       600
     gccctcaacc gccggatcct cgacgcccag tgcataaagc gccgggggaa gccggaggac       660
     gtgggcaacc tggtgacgtt tctggccagc gaggaggcct ccttcatcac cgggcagacc       720
     atagagatcg acggcggatg ggcgatgcac tga                                    753
//

If you have problems or comments...

PBIL Back to PBIL home page