(data stored in ACNUC7421 zone)

EMBL: CP000386.PE525

CP000386.PE525       Location/Qualifiers
FT   CDS_pept        561533..562660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0532"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sco:SCO0366 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03506"
FT                   /db_xref="InterPro:IPR027839"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM2"
FT                   /protein_id="ABG03506.1"
FT                   /translation="MVRLWGGEYGRRELLRRVGRLEQVAGVRLVTLGDGAGRGVRALEF
FT                   RTGSGLSFDVLVDRAFDIGRCEFGGRSLCWLSGVGTSGPWFYEPEGLGFFRTFGGGMLT
FT                   TCGLDHTLFMAEDTAEQYHYPPKRTERYGLHGRVSNLPARLVGYGERWEGEGCVLWAEG
FT                   EVLQAAVFGERLLLRRRVEARVGESRITVRDEVENAGFDPTPHMYLYHVNVGFPVVDEG
FT                   AELLAPAVSVTPRGDYPAEGYGRFHAPEEGYVERVFEHELAAEEGGTVPVAVVNRRLGL
FT                   GVYQLYDRNQFPHHFVWRMLGEGTYVVGIEPSTNRTAGRLDARRRGELIRLRAGERRAY
FT                   GMELGVLEGESEIERFARRVASSKARRARREGEAR"
     atggtgcggc tctggggcgg ggagtacggc cggcgggagc tgctgcgccg cgtcgggcgc        60
     ctcgagcagg tggcgggcgt gcgcctggtt accctggggg acggggcggg gcgcggggtg       120
     cgggcgctgg agttccgcac cggcagcggg ctctccttcg acgtgctggt ggaccgcgcc       180
     ttcgacatcg ggcgctgcga gttcgggggg cgctccctgt gctggctctc cggggtgggg       240
     acgagcggcc cctggttcta cgagccggag gggctggggt tcttccgcac cttcgggggc       300
     ggcatgctca ccacctgcgg cctggatcac accctgttca tggccgagga caccgccgag       360
     cagtaccact acccgccgaa gcgcaccgag cggtacggcc tgcacggtcg ggtctccaac       420
     ctcccggccc ggctggtcgg ctacggcgag aggtgggagg gggagggttg cgtgctctgg       480
     gccgaggggg aggtcctgca ggcggcggtg ttcggggagc ggctgttgct gcggcggcgc       540
     gtcgaggccc gggtgggcga gtcgcggatc accgtccgcg acgaggtgga gaacgcgggc       600
     ttcgatccca ccccgcacat gtacctctat cacgtgaacg tggggttccc cgtggtggac       660
     gagggggccg agctgctcgc ccccgcggtc tccgtaaccc cgcgggggga ctacccggcg       720
     gaggggtacg gccgtttcca cgcgccggag gagggctacg tggagcgggt cttcgagcac       780
     gagctcgccg ccgaggaggg cgggacggtg ccggtggcgg tggtcaaccg gaggctgggg       840
     ctcggcgtct accagctcta cgaccgcaac cagttccccc accacttcgt gtggaggatg       900
     ctcggagagg ggacgtacgt ggtggggatc gagccgagca cgaaccgcac cgccgggcgc       960
     ctcgacgccc ggcggcgggg ggagctgatc cggctgcggg caggggagag gcgcgcctac      1020
     gggatggagc tgggcgtcct ggagggggag tcggagatag agaggttcgc ccggcgggtg      1080
     gcgtcttcga aggcccggcg ggcgcggaga gagggagagg cacgatga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page