(data stored in ACNUC7421 zone)

EMBL: CP000386.PE526

CP000386.PE526       Location/Qualifiers
FT   CDS_pept        562657..563793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Rxyl_0533"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bja:bll7907
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Rxyl_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ABG03507"
FT                   /db_xref="GOA:Q1AYM1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:Q1AYM1"
FT                   /protein_id="ABG03507.1"
FT                   /translation="MRGTAAEPAGRRERLEDILIVDCDVHVHESPGELAPYCEMPWRRA
FT                   LENIADVEEYYLDIPGFSPGMTWYEARFPSGHEGRRMVHDARQMREELDAIHVDIGILF
FT                   PDHLLKIALITQDEYAAALARAYNRWLLEKWCSPERKLLGCILACPQDPEDAAREIRRY
FT                   AREPGMVGVYLPCAGLDPLWGNRRYDPIYEAAQEADLPVLLHSVTVVHPVFPFNLHGFE
FT                   TEFGRHICGHTFAIMANLVHMISTGVPERYPRLRIAVTEAGVSWVPFLMNRMDKEYLER
FT                   RREIPLVKQRPSRYLKRMYFATQPVEEPEDLGDLVRLVELYDGEDRTIFASDWPHHDFD
FT                   HPMKVHQAPFSNEARRKIFGENALGLFRIDAQGRRLNL"
     atgaggggta cggcggcgga gcccgcgggg cgcagggaga ggctggagga catcctgatc        60
     gtggactgcg acgtgcacgt ccacgagtcc cccggcgagc tcgcgcccta ctgcgagatg       120
     ccctggcgca gggcgctgga gaacatcgcg gacgtcgagg agtactacct ggacatcccc       180
     ggcttctccc ccggcatgac ctggtacgag gcccgcttcc ccagcgggca tgaggggcgg       240
     cggatggtgc acgacgcgcg gcagatgcgc gaggagctgg acgccatcca cgtagacata       300
     ggcatcctct tcccggacca cctgctgaag atcgcgctca tcacccagga cgagtacgcc       360
     gccgcgctgg ccagggcgta caaccgctgg ctcctggaga agtggtgctc gccggagagg       420
     aagctcctgg gctgcatcct ggcctgcccc caggacccgg aggacgccgc cagggagatc       480
     cggcgctacg cgagggagcc cgggatggtg ggggtgtacc tcccgtgcgc cgggctcgac       540
     ccgctgtggg gcaaccgccg ctacgacccc atctacgagg cggcgcagga ggcggatctc       600
     ccggtcctcc tgcacagcgt caccgtcgtg cacccggtct tcccgttcaa cctgcacggc       660
     ttcgagaccg agttcgggcg gcacatctgc gggcacacct tcgccatcat ggccaacctg       720
     gtgcacatga tctccaccgg ggtcccggag cgctacccgc ggctgcggat cgccgtaacg       780
     gaggccgggg tctcctgggt ccccttcctg atgaaccgga tggacaagga gtacctggag       840
     cgccggcggg agatacccct ggtgaagcag cgccccagcc gctacctcaa gcggatgtac       900
     ttcgccaccc agcccgtcga ggagccggag gatctggggg acctggtgag gctcgtggag       960
     ctctacgacg gcgaggacag gaccatcttc gcctccgact ggccccacca cgacttcgac      1020
     caccccatga aggtccacca ggccccgttc tcgaacgagg cgcggcgcaa gatcttcggg      1080
     gagaacgcgc tcgggctctt caggatcgac gcgcagggcc ggaggctgaa cctctga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page